Recombinant Human PTHLH Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | PTHLH-4047H |
| Product Overview : | PTHLH MS Standard C13 and N15-labeled recombinant protein (NP_945317) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene is a member of the parathyroid hormone family. This hormone, via its receptor, PTHR1, regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. It is responsible for most cases of humoral hypercalcemia of malignancy, and mutations in this gene are associated with brachydactyly type E2 (BDE2). Alternatively spliced transcript variants have been found for this gene. There is also evidence for alternative translation initiation from non-AUG (CUG and GUG) start sites, downstream of the initiator AUG codon, resulting in nuclear forms of this hormone. |
| Molecular Mass : | 16 kDa |
| AA Sequence : | MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | PTHLH parathyroid hormone-like hormone [ Homo sapiens (human) ] |
| Official Symbol | PTHLH |
| Synonyms | PTHLH; parathyroid hormone-like hormone; parathyroid hormone-related protein; HHM; osteostatin; PLP; PTHR; PTHRP; PTH-rP; PTH-related protein; parathyroid hormone-like related protein; BDE2; MGC14611; |
| Gene ID | 5744 |
| mRNA Refseq | NM_198966 |
| Protein Refseq | NP_945317 |
| MIM | 168470 |
| UniProt ID | P12272 |
| ◆ Recombinant Proteins | ||
| PTHLH-3695R | Recombinant Rhesus monkey PTHLH Protein, His-tagged | +Inquiry |
| PTHLH-665H | Recombinant Human PTHLH Protein, His-tagged | +Inquiry |
| PTHLH-3513R | Recombinant Rhesus Macaque PTHLH Protein, His (Fc)-Avi-tagged | +Inquiry |
| PTHLH-7764C | Recombinant Cattle PTHLH protein, His & S-tagged | +Inquiry |
| PTHLH-6703H | Recombinant Human PTHLH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Native Proteins | ||
| PTHLH-322H | Recombinant Human PTHLH Protein, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PTHLH-2702HCL | Recombinant Human PTHLH 293 Cell Lysate | +Inquiry |
| PTHLH-2701HCL | Recombinant Human PTHLH 293 Cell Lysate | +Inquiry |
| PTHLH-2703HCL | Recombinant Human PTHLH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTHLH Products
Required fields are marked with *
My Review for All PTHLH Products
Required fields are marked with *
