Recombinant Human PTN Protein
Cat.No. : | PTN-232H |
Product Overview : | Recombinant Human PTN Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Pleiotrophin (PTN) is a heparin-binding growth factor that has mitogenic effects on fibroblast, epithelial, and endothelial cells. PTN is made by many tissues, but is predominantly secreted by nervous tissue during development. PTN induces neurite outgrowth and is involved in tumor growth and metastasis. PTN binds with low affinity to the cell surface receptor nucleolin to inhibit HIV-1 infection. PNT also binds the receptor protein tyrosine phosphatase type Z (PTPRZ), syndecan-3, and anaplastic lymphoma kinase (ALK) receptors. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 15.4 kDa (137 aa) |
AA Sequence : | MGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | PTN pleiotrophin [ Homo sapiens (human) ] |
Official Symbol | PTN |
Synonyms | PTN; pleiotrophin; NEGF1, neurite growth promoting factor 1; HBGF8; HBNF; heparin binding growth factor 8; HBBM; OSF-1; HB-GAM; HBGF-8; HBNF-1; osteoblast-specific factor 1; heparin-binding brain mitogen; heparin-binding growth factor 8; heparin affin regulatory protein; neurite growth-promoting factor 1; heparin-binding growth-associated molecule; heparin-binding neurite outgrowth-promoting factor 1; pleiotrophin (heparin binding growth factor 8, neurite growth-promoting factor 1); HARP; NEGF1; |
Gene ID | 5764 |
mRNA Refseq | NM_002825 |
Protein Refseq | NP_002816 |
MIM | 162095 |
UniProt ID | P21246 |
◆ Recombinant Proteins | ||
Ptn-2001R | Recombinant Rat Ptn Protein, His-tagged | +Inquiry |
PTN-261H | Recombinant Human PTN Protein (Gly33-Asp168), C-His tagged, Animal-free, Carrier-free | +Inquiry |
PTN-232H | Recombinant Human PTN Protein | +Inquiry |
Ptn-6790M | Recombinant Mouse Ptn protein, His-tagged | +Inquiry |
PTN-1034M | Recombinant Mouse PTN protein(Met1-Asp168) | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTN-1524MCL | Recombinant Mouse PTN cell lysate | +Inquiry |
PTN-001MCL | Recombinant Mouse PTN cell lysate | +Inquiry |
PTN-001HCL | Recombinant Human PTN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTN Products
Required fields are marked with *
My Review for All PTN Products
Required fields are marked with *