Recombinant Human PTN protein
Cat.No. : | PTN-30874TH |
Product Overview : | Recombinant Human PTN protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 136 |
Description : | The protein encoded by this gene is a secreted heparin-binding growth factor. The protein has significant roles in cell growth and survival, cell migration, angiogenesis and tumorigenesis. Alternative splicing and the use of alternative promoters results in multiple transcript variants. |
Form : | Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity was measured by its ability to enhance neurite outgrowth of E16-E18 rat embryonic cortical neurons, when neurons were plated on 96 well culture plates that had been pre-coated with 100 µl/well of a solution of 5-10 µg/ml rHuPTN. |
Molecular Mass : | Approximately 15.3 kDa, a single non-glycosylated polypeptide chain containing 136 amino acids. |
AA Sequence : | GKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD |
Endotoxin : | Less than 0.1 EU/μg of rHuPTN as determined by LAL method. |
Purity : | >96% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | PTN |
Official Symbol | PTN |
Synonyms | PTN; pleiotrophin; NEGF1, neurite growth promoting factor 1; HBGF8; HBNF; heparin binding growth factor 8; HBBM; OSF-1; HB-GAM; HBGF-8; HBNF-1; osteoblast-specific factor 1; heparin-binding brain mitogen; heparin-binding growth factor 8; heparin affin regulatory protein; neurite growth-promoting factor 1; heparin-binding growth-associated molecule; heparin-binding neurite outgrowth-promoting factor 1; pleiotrophin (heparin binding growth factor 8, neurite growth-promoting factor 1); HARP; NEGF1; |
Gene ID | 5764 |
mRNA Refseq | NM_002825 |
Protein Refseq | NP_002816 |
MIM | 162095 |
UniProt ID | P21246 |
◆ Recombinant Proteins | ||
PTN-6789C | Recombinant Cattle PTN protein, His-tagged | +Inquiry |
PTN-630H | Active Recombinant Human PTN protein | +Inquiry |
Ptn-6790M | Recombinant Mouse Ptn protein, His-tagged | +Inquiry |
PTN-4484R | Recombinant Rat PTN Protein, His (Fc)-Avi-tagged | +Inquiry |
PTN-673H | Recombinant Human PTN Protein, GST-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTN-001HCL | Recombinant Human PTN cell lysate | +Inquiry |
PTN-1524MCL | Recombinant Mouse PTN cell lysate | +Inquiry |
PTN-001MCL | Recombinant Mouse PTN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTN Products
Required fields are marked with *
My Review for All PTN Products
Required fields are marked with *
0
Inquiry Basket