Recombinant Human PTN protein, GST-tagged
Cat.No. : | PTN-301230H |
Product Overview : | Recombinant Human PTN (94-168 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Gln94-Asp168 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | QFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PTN pleiotrophin [ Homo sapiens ] |
Official Symbol | PTN |
Synonyms | PTN; pleiotrophin; NEGF1, neurite growth promoting factor 1; HBGF8; HBNF; heparin binding growth factor 8; HBBM; OSF-1; HB-GAM; HBGF-8; HBNF-1; osteoblast-specific factor 1; heparin-binding brain mitogen; heparin-binding growth factor 8; heparin affin regulatory protein; neurite growth-promoting factor 1; heparin-binding growth-associated molecule; heparin-binding neurite outgrowth-promoting factor 1; pleiotrophin (heparin binding growth factor 8, neurite growth-promoting factor 1); HARP; NEGF1; |
Gene ID | 5764 |
mRNA Refseq | NM_002825 |
Protein Refseq | NP_002816 |
MIM | 162095 |
UniProt ID | P21246 |
◆ Recombinant Proteins | ||
PTN-6789C | Recombinant Cattle PTN protein, His-tagged | +Inquiry |
PTN-1180Z | Recombinant Zebrafish PTN | +Inquiry |
PTN-301230H | Recombinant Human PTN protein, GST-tagged | +Inquiry |
PTN-630H | Active Recombinant Human PTN protein | +Inquiry |
PTN-232H | Recombinant Human PTN Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTN-1524MCL | Recombinant Mouse PTN cell lysate | +Inquiry |
PTN-001HCL | Recombinant Human PTN cell lysate | +Inquiry |
PTN-001MCL | Recombinant Mouse PTN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTN Products
Required fields are marked with *
My Review for All PTN Products
Required fields are marked with *