Recombinant Human PTPLAD1 protein, GST-tagged
Cat.No. : | PTPLAD1-3740H |
Product Overview : | Recombinant Human PTPLAD1 protein(1-149 aa), fused to GST tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-149 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMELRAKEEERLNKLRLESEGSPETLTNLRKGY |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PTPLAD1 protein tyrosine phosphatase-like A domain containing 1 [ Homo sapiens ] |
Official Symbol | PTPLAD1 |
Synonyms | PTPLAD1; protein tyrosine phosphatase-like A domain containing 1; 3-hydroxyacyl-CoA dehydratase 3; B ind1; HSPC121; hB-ind1; butyrate-induced protein 1; butyrate-induced transcript 1; protein tyrosine phosphatase-like protein PTPLAD1; protein-tyrosine phosphatase-like A domain-containing protein 1; HACD3; B-IND1; FLJ90376; |
Gene ID | 51495 |
mRNA Refseq | NM_016395 |
Protein Refseq | NP_057479 |
UniProt ID | Q9P035 |
◆ Recombinant Proteins | ||
PTPLAD1-3200H | Recombinant Human PTPLAD1 protein, His-tagged | +Inquiry |
PTPLAD1-13670M | Recombinant Mouse PTPLAD1 Protein | +Inquiry |
PTPLAD1-1754C | Recombinant Chicken PTPLAD1 | +Inquiry |
PTPLAD1-7272M | Recombinant Mouse PTPLAD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PTPLAD1-4070Z | Recombinant Zebrafish PTPLAD1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTPLAD1-1435HCL | Recombinant Human PTPLAD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTPLAD1 Products
Required fields are marked with *
My Review for All PTPLAD1 Products
Required fields are marked with *