Recombinant Human PTPN23 Protein, GST-tagged

Cat.No. : PTPN23-01H
Product Overview : Human PTPN23 partial ORF ( NP_056281.1, 1233 a.a. - 1328 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the non-receptor type protein-tyrosine phosphatase family. The encoded protein may be involved in the regulation of small nuclear ribonucleo protein assembly and pre-mRNA splicing by modifying the survival motor neuron (SMN) complex. The encoded protein additionally plays a role in ciliogenesis and is part of endosomal sorting complex required for transport (ESCRT) pathways. This gene may serve a tumor suppressor function.
Molecular Mass : 36.3 kDa
AA Sequence : RVVLRSGKDDYINASCVEGLSPYCPPLVATQAPLPGTAADFWLMVHEQKVSVIVMLVSEAEMEKQKVARYFPTERGQPMVHGALSLALSSVRSTET
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PTPN23 protein tyrosine phosphatase non-receptor type 23 [ Homo sapiens (human) ]
Official Symbol PTPN23
Synonyms PTPN23; protein tyrosine phosphatase non-receptor type 23; HDPTP; HD-PTP; NEDBASS; PTP-TD14; tyrosine-protein phosphatase non-receptor type 23; his domain-containing protein tyrosine phosphatase; protein tyrosine phosphatase TD14; EC 3.1.3.48
Gene ID 25930
mRNA Refseq NM_015466
Protein Refseq NP_056281
MIM 606584
UniProt ID Q9H3S7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTPN23 Products

Required fields are marked with *

My Review for All PTPN23 Products

Required fields are marked with *

0
cart-icon