Recombinant Human PTPN4 protein, GST-tagged
Cat.No. : | PTPN4-683H |
Product Overview : | Recombinant Human PTPN4 protein(NP_002821)(604-927 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 604-927 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | NAVYDVVEEKLENEPDFQYIPEKAPLDSVHQDDHSLRESMIQLAEGLITGTVLTQFDQLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVILKGNEDYINANYINMEIPSSSIINQYIACQGPLPHTCTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQVTCHSEEGNTAYIFRKMTLFNQEKNESRPLTQIQYIAWPDHGVPDDSSDFLDFVCHVRNKRAGKEEPVVVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQYRFVCEAILKVYEEGFVKPLTTSTNK |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PTPN4 protein tyrosine phosphatase, non-receptor type 4 (megakaryocyte) [ Homo sapiens ] |
Official Symbol | PTPN4 |
Synonyms | PTPN4; protein tyrosine phosphatase, non-receptor type 4 (megakaryocyte); tyrosine-protein phosphatase non-receptor type 4; PTPMEG; MEG; PTPase-MEG1; megakaryocyte phosphatase; protein tyrosine phosphatase MEG1; protein-tyrosine phosphatase MEG1; megakaryocyte protein-tyrosine phosphatase; PTPMEG1; |
Gene ID | 5775 |
mRNA Refseq | NM_002830 |
Protein Refseq | NP_002821 |
MIM | 176878 |
UniProt ID | P29074 |
◆ Recombinant Proteins | ||
PTPN4-2005H | Recombinant Human PTPN4 Protein, His&GST-tagged | +Inquiry |
PTPN4-683H | Recombinant Human PTPN4 protein, GST-tagged | +Inquiry |
PTPN4-3524R | Recombinant Rhesus Macaque PTPN4 Protein, His (Fc)-Avi-tagged | +Inquiry |
PTPN4-603H | Recombinant Human PTPN4, GST-tagged | +Inquiry |
PTPN4-3707R | Recombinant Rhesus monkey PTPN4 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTPN4 Products
Required fields are marked with *
My Review for All PTPN4 Products
Required fields are marked with *
0
Inquiry Basket