Recombinant Human PTPN4 protein, GST-tagged

Cat.No. : PTPN4-683H
Product Overview : Recombinant Human PTPN4 protein(NP_002821)(604-927 aa), fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 604-927 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : NAVYDVVEEKLENEPDFQYIPEKAPLDSVHQDDHSLRESMIQLAEGLITGTVLTQFDQLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVILKGNEDYINANYINMEIPSSSIINQYIACQGPLPHTCTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQVTCHSEEGNTAYIFRKMTLFNQEKNESRPLTQIQYIAWPDHGVPDDSSDFLDFVCHVRNKRAGKEEPVVVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQYRFVCEAILKVYEEGFVKPLTTSTNK
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
Concentration : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name PTPN4 protein tyrosine phosphatase, non-receptor type 4 (megakaryocyte) [ Homo sapiens ]
Official Symbol PTPN4
Synonyms PTPN4; protein tyrosine phosphatase, non-receptor type 4 (megakaryocyte); tyrosine-protein phosphatase non-receptor type 4; PTPMEG; MEG; PTPase-MEG1; megakaryocyte phosphatase; protein tyrosine phosphatase MEG1; protein-tyrosine phosphatase MEG1; megakaryocyte protein-tyrosine phosphatase; PTPMEG1;
Gene ID 5775
mRNA Refseq NM_002830
Protein Refseq NP_002821
MIM 176878
UniProt ID P29074

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTPN4 Products

Required fields are marked with *

My Review for All PTPN4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon