Recombinant Human PTPN4 protein, GST-tagged

• Cat.No.: PTPN4-683H
• Product Overview: Recombinant Human PTPN4 protein(NP_002821)(604-927 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 604-927 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: NAVYDVVEEKLENEPDFQYIPEKAPLDSVHQDDHSLRESMIQLAEGLITGTVLTQFDQLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVILKGNEDYINANYINMEIPSSSIINQYIACQGPLPHTCTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQVTCHSEEGNTAYIFRKMTLFNQEKNESRPLTQIQYIAWPDHGVPDDSSDFLDFVCHVRNKRAGKEEPVVVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQYRFVCEAILKVYEEGFVKPLTTSTNK
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
• Concentration: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PTPN4 protein tyrosine phosphatase, non-receptor type 4 (megakaryocyte) [ Homo sapiens ]
• Official Symbol: PTPN4
• Synonyms: PTPN4; protein tyrosine phosphatase, non-receptor type 4 (megakaryocyte); tyrosine-protein phosphatase non-receptor type 4; PTPMEG; MEG; PTPase-MEG1; megakaryocyte phosphatase; protein tyrosine phosphatase MEG1; protein-tyrosine phosphatase MEG1; megakaryocyte protein-tyrosine phosphatase; PTPMEG1
• Gene ID: 5775
• mRNA Refseq: NM_002830
• Protein Refseq: NP_002821
• MIM: 176878
• UniProt ID: P29074