Recombinant Human PTPN5 protein, His-SUMO-tagged
Cat.No. : | PTPN5-3389H |
Product Overview : | Recombinant Human PTPN5 protein(P54829)(300-555aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 300-555aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 45.5 kDa |
AA Sequence : | LQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPLSSYINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCAPIIVHCSAGIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PTPN5 protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) [ Homo sapiens ] |
Official Symbol | PTPN5 |
Synonyms | PTPN5; protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched); PTPSTEP; STEP; |
Gene ID | 5776 |
MIM | 176879 |
UniProt ID | P54829 |
◆ Recombinant Proteins | ||
Ptpn5-8093M | Recombinant Mouse Ptpn5 protein, His & T7-tagged | +Inquiry |
PTPN5-6777HF | Recombinant Full Length Human PTPN5 Protein, GST-tagged | +Inquiry |
PTPN5-3708R | Recombinant Rhesus monkey PTPN5 Protein, His-tagged | +Inquiry |
PTPN5-7282M | Recombinant Mouse PTPN5 Protein, His (Fc)-Avi-tagged | +Inquiry |
PTPN5-2057H | Recombinant Human PTPN5 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTPN5-2682HCL | Recombinant Human PTPN5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTPN5 Products
Required fields are marked with *
My Review for All PTPN5 Products
Required fields are marked with *