Recombinant Human PTPRB protein, His-SUMO-tagged
Cat.No. : | PTPRB-3391H |
Product Overview : | Recombinant Human PTPRB protein(P23467)(1643-1997aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1643-1997aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 57.4 kDa |
AA Sequence : | RQKVSHGRERPSARLSIRRDRPLSVHLNLGQKGNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDRILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLRSEQENPLFPIYENVNPEYHRDPVYSRH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PTPRB protein tyrosine phosphatase, receptor type, B [ Homo sapiens ] |
Official Symbol | PTPRB |
Synonyms | PTPRB; protein tyrosine phosphatase, receptor type, B; PTPB; receptor-type tyrosine-protein phosphatase beta; VE-PTP; vascular endothelial protein tyrosine phosphatase; protein tyrosine phosphatase, receptor type, beta polypeptide; HPTPB; VEPTP; HPTP-BETA; R-PTP-BETA; FLJ44133; MGC59935; MGC142023; DKFZp686E2262; DKFZp686H15164; |
Gene ID | 5787 |
mRNA Refseq | NM_001109754 |
Protein Refseq | NP_001103224 |
MIM | 176882 |
UniProt ID | P23467 |
◆ Recombinant Proteins | ||
Ptprb-5244M | Recombinant Mouse Ptprb Protein, Myc/DDK-tagged | +Inquiry |
PTPRB-6103H | Recombinant Human PTPRB Protein (Ala1655-Asp1918), N-His tagged | +Inquiry |
PTPRB-744HFL | Recombinant Full Length Human PTPRB Protein, C-Flag-tagged | +Inquiry |
Ptprb-1433M | Recombinant Mouse Ptprb protein, His & T7-tagged | +Inquiry |
Ptprb-1434R | Recombinant Rat Ptprb protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTPRB Products
Required fields are marked with *
My Review for All PTPRB Products
Required fields are marked with *
0
Inquiry Basket