Recombinant Human PTPRJ protein(1001-1330 aa), C-His-tagged
Cat.No. : | PTPRJ-2837H |
Product Overview : | Recombinant Human PTPRJ protein(Q12913)(1001-1330 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1001-1330 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | KDAKNNEVSFSQIKPKKSKLIRVENFEAYFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDSKVDLIYQNTTAMTIYENLAPVTTFG |
Gene Name | PTPRJ protein tyrosine phosphatase, receptor type, J [ Homo sapiens ] |
Official Symbol | PTPRJ |
Synonyms | PTPRJ; protein tyrosine phosphatase, receptor type, J; receptor-type tyrosine-protein phosphatase eta; CD148; DEP1; HPTPeta; DEP-1; R-PTP-J; HPTP eta; CD148 antigen; density-enhanced phosphatase 1; protein-tyrosine phosphatase eta; human density enhanced phosphatase-1; protein-tyrosine phosphatase receptor type J; susceptibility to colon cancer 1, mouse, homolog of; protein tyrosine phosphatase, receptor type, J polypeptide; SCC1; R-PTP-ETA; |
Gene ID | 5795 |
mRNA Refseq | NM_001098503 |
Protein Refseq | NP_001091973 |
MIM | 600925 |
UniProt ID | Q12913 |
◆ Recombinant Proteins | ||
PTPRJ-2839H | Recombinant Human PTPRJ protein(41-460 aa), C-His-tagged | +Inquiry |
PTPRJ-1579R | Recombinant Rhesus Monkey PTPRJ Protein | +Inquiry |
PTPRJ-6189C | Recombinant Chicken PTPRJ | +Inquiry |
PTPRJ-2248H | Recombinant Human PTPRJ Protein, Myc/DDK-tagged | +Inquiry |
Ptprj-7100M | Recombinant Mouse Ptprj protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTPRJ-2675HCL | Recombinant Human PTPRJ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTPRJ Products
Required fields are marked with *
My Review for All PTPRJ Products
Required fields are marked with *
0
Inquiry Basket