Recombinant Human PTPRN protein, His-tagged
Cat.No. : | PTPRN-258H |
Product Overview : | Recombinant Human PTPRN (Arg576-Gln950) fussed with His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 576-950 a.a. |
Description : | Receptor-type tyrosine-protein phosphatase-like N (PTPRN) belongs to the protein-tyrosine phosphatase family and receptor class 8 subfamily. PTPRN contains 1 tyrosine-protein phosphatase domain, is expressed in neuroendocrine cells only. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. It implicated in neuroendocrine secretory processes. It may be involved in processes specific for neurosecretory granules, such as their biogenesis, trafficking or regulated exocytosis or may have a general role in neuroendocrine functions. It seems to lack intrinsic enzyme activity, may play a role in the regulation of secretory granules via its interaction with SNTB2. This PTP was found to be an autoantigen that is reactive with insulin-dependent diabetes mellitus (IDDM) patient sera, and thus may be a potential target of autoimmunity in diabetes mellitus. |
Form : | Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH8.0 |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMRQQDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEGP PEPSRVSSVSSQFSDAAQASPSSHSSTPSWCEEPAQANMDISTGHMILAYMEDHLRNRDRLAKEW QALCAYQAEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMP AYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVNLVSEH IWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPLLDFRRKVNKCYRGRSCPIIVH CSDGAGRTGTYILIDMVLNRMAKGVKEIDIAATLEHVRDQRPGLVRSKDQFEFALTAVAEEVNAI LKALPQ |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles. |
Gene Name | PTPRN protein tyrosine phosphatase, receptor type, N [ Homo sapiens ] |
Official Symbol | PTPRN |
Synonyms | IA2; IA-2; ICA512; R-PTP-N; IA-2/PTP; receptor-type tyrosine-protein phosphatase-like N; ICA 512; PTP IA-2; islet cell antigen 2; islet cell antigen 512; islet cell autoantigen 3; protein tyrosine phosphatase-like N |
Gene ID | 5798 |
mRNA Refseq | NM_002846 |
Protein Refseq | NP_002837 |
MIM | 601773 |
UniProt ID | Q16849 |
Chromosome Location | 2q35-q36.1 |
Pathway | Type I diabetes mellitus, organism-specific biosystem; Type I diabetes mellitus, conserved biosystem |
Function | GTPase binding; protein binding; NOT protein tyrosine phosphatase activity |
◆ Recombinant Proteins | ||
PTPRN-0047H | Recombinant Human PTPRN Protein | +Inquiry |
PTPRN-4500R | Recombinant Rat PTPRN Protein, His (Fc)-Avi-tagged | +Inquiry |
PTPRN-6112H | Recombinant Human PTPRN Protein (Met389-Arg575), N-His tagged | +Inquiry |
PTPRN-4841R | Recombinant Rat PTPRN Protein | +Inquiry |
PTPRN-6111H | Recombinant Human PTPRN Protein (Met687-Gln979), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTPRN-1440HCL | Recombinant Human PTPRN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTPRN Products
Required fields are marked with *
My Review for All PTPRN Products
Required fields are marked with *
0
Inquiry Basket