Recombinant Human PTPRN Protein, His-tagged
| Cat.No. : | PTPRN-03H |
| Product Overview : | Recombinant Human PTPRN protein(NP_001186692.1), fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 256-575 a.a. |
| Form : | PBS (pH 7.4) |
| Molecular Mass : | The protein has a calculated MW of 34.8 kDa. |
| AA Sequence : | MHPGHSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELRQLTPEQLSTLLTLLQLLPKGAGRNPGGVVNVGADIKKTMEGPVEGRDTAELPARTSPMPGHPTASPTSSEVQQVPSPVSSEPPKAARPPVTPVLLEKKSPLGQSQPTVAGQPSARPAAEEYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIRHNEQNLSLADVTQQAGLVKSELEAQTGLQILQTGVGQREEAAAVLPQTAHSTSPMRLEHHHHHH |
| Purity : | >90 by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1.5 mg/ml |
| Gene Name | PTPRN protein tyrosine phosphatase receptor type N [ Homo sapiens (human) ] |
| Official Symbol | PTPRN |
| Synonyms | IA2; IA-2; ICA512; R-PTP-N; IA-2/PTP; PTPRN |
| Gene ID | 5798 |
| mRNA Refseq | NM_001199763.2 |
| Protein Refseq | NP_001186692.1 |
| MIM | 601773 |
| UniProt ID | Q16849 |
| ◆ Recombinant Proteins | ||
| PTPRN-6111H | Recombinant Human PTPRN Protein (Met687-Gln979), N-His tagged | +Inquiry |
| PTPRN-98H | Recombinant Human PTPRN Protein, His-tagged | +Inquiry |
| PTPRN-5755H | Recombinant Human PTPRN protein, His-Myc-tagged | +Inquiry |
| PTPRN-675H | Recombinant Human PTPRN Protein, DDK-tagged | +Inquiry |
| PTPRN-6112H | Recombinant Human PTPRN Protein (Met389-Arg575), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PTPRN-1440HCL | Recombinant Human PTPRN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTPRN Products
Required fields are marked with *
My Review for All PTPRN Products
Required fields are marked with *
