Recombinant Human PTPRN Protein, His-tagged

Cat.No. : PTPRN-03H
Product Overview : Recombinant Human PTPRN protein(NP_001186692.1), fused to His-tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 256-575 a.a.
Form : PBS (pH 7.4)
Molecular Mass : The protein has a calculated MW of 34.8 kDa.
AA Sequence : MHPGHSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELRQLTPEQLSTLLTLLQLLPKGAGRNPGGVVNVGADIKKTMEGPVEGRDTAELPARTSPMPGHPTASPTSSEVQQVPSPVSSEPPKAARPPVTPVLLEKKSPLGQSQPTVAGQPSARPAAEEYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIRHNEQNLSLADVTQQAGLVKSELEAQTGLQILQTGVGQREEAAAVLPQTAHSTSPMRLEHHHHHH
Purity : >90 by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1.5 mg/ml
Gene Name PTPRN protein tyrosine phosphatase receptor type N [ Homo sapiens (human) ]
Official Symbol PTPRN
Synonyms IA2; IA-2; ICA512; R-PTP-N; IA-2/PTP; PTPRN
Gene ID 5798
mRNA Refseq NM_001199763.2
Protein Refseq NP_001186692.1
MIM 601773
UniProt ID Q16849

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTPRN Products

Required fields are marked with *

My Review for All PTPRN Products

Required fields are marked with *

0
cart-icon