Recombinant Human PTPRN Protein, His-tagged
Cat.No. : | PTPRN-03H |
Product Overview : | Recombinant Human PTPRN protein(NP_001186692.1), fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 256-575 a.a. |
Form : | PBS (pH 7.4) |
Molecular Mass : | The protein has a calculated MW of 34.8 kDa. |
AA Sequence : | MHPGHSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELRQLTPEQLSTLLTLLQLLPKGAGRNPGGVVNVGADIKKTMEGPVEGRDTAELPARTSPMPGHPTASPTSSEVQQVPSPVSSEPPKAARPPVTPVLLEKKSPLGQSQPTVAGQPSARPAAEEYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIRHNEQNLSLADVTQQAGLVKSELEAQTGLQILQTGVGQREEAAAVLPQTAHSTSPMRLEHHHHHH |
Purity : | >90 by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.5 mg/ml |
Gene Name | PTPRN protein tyrosine phosphatase receptor type N [ Homo sapiens (human) ] |
Official Symbol | PTPRN |
Synonyms | IA2; IA-2; ICA512; R-PTP-N; IA-2/PTP; PTPRN |
Gene ID | 5798 |
mRNA Refseq | NM_001199763.2 |
Protein Refseq | NP_001186692.1 |
MIM | 601773 |
UniProt ID | Q16849 |
◆ Recombinant Proteins | ||
PTPRN-2064H | Recombinant Human PTPRN, His-tagged | +Inquiry |
PTPRN-676H | Recombinant Human PTPRN Protein, His-tagged | +Inquiry |
PTPRN-01H | Recombinant Human PTPRN | +Inquiry |
PTPRN-258H | Recombinant Human PTPRN protein, His-tagged | +Inquiry |
PTPRN-5755H | Recombinant Human PTPRN protein, His-Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTPRN-1440HCL | Recombinant Human PTPRN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTPRN Products
Required fields are marked with *
My Review for All PTPRN Products
Required fields are marked with *