Recombinant Human PTPRN Protein, His-tagged

• Cat.No.: PTPRN-98H
• Product Overview: Recombinant Human PTPRN Protein, fused to His-tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 2-321 a.a.
• Description: The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single catalytic domain, and thus represents a receptor-type PTP. This PTP was found to be an autoantigen that is reactive with insulin-dependent diabetes mellitus (IDDM) patient sera, and thus may be a potential target of autoimmunity in diabetes mellitus. Alternate splicing results in multiple transcript variants.
• Form: PBS (pH 7.4).
• Molecular Mass: 34.8 kDa
• AA Sequence: MHPGHSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELRQLTPEQLSTLLTLLQLLPKGAGRNPGGVVNVGADIKKTMEGPVEGRDTAELPARTSPMPGHPTASPTSSEVQQVPSPVSSEPPKAARPPVTPVLLEKKSPLGQSQPTVAGQPSARPAAEEYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIRHNEQNLSLADVTQQAGLVKSELEAQTGLQILQTGVGQREEAAAVLPQTAHSTSPMRLEHHHHHH
• Purity: >90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1.5 mg/ml

Gene Information

• Gene Name: PTPRN protein tyrosine phosphatase receptor type N [ Homo sapiens (human) ]
• Official Symbol: PTPRN
• Synonyms: IA2; IA-2; ICA512; R-PTP-N; IA-2/PTP
• Gene ID: 5798
• mRNA Refseq: NM_001199763
• Protein Refseq: NP_001186692
• MIM: 601773
• UniProt ID: Q16849