Recombinant Human PTPRO

Cat.No. : PTPRO-28582TH
Product Overview : Recombinant fragment of Human GLEPP1 with N-terminal proprietary tag.Mol Wt 36.52 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 180 amino acids
Description : This gene encodes a member of the R3 subtype family of receptor-type protein tyrosine phosphatases. These proteins are localized to the apical surface of polarized cells and may have tissue-specific functions through activation of Src family kinases. This gene contains two distinct promoters, and alternatively spliced transcript variants encoding multiple isoforms have been observed. The encoded proteins may have multiple isoform-specific and tissue-specific functions, including the regulation of osteoclast production and activity, inhibition of cell proliferation and facilitation of apoptosis. This gene is a candidate tumor suppressor, and decreased expression of this gene has been observed in several types of cancer.
Molecular Weight : 36.520kDa inclusive of tags
Tissue specificity : Glomerulus of kidney. Also detected in brain, lung and placenta.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SITVLTKPLPVTSVSIYDYKPSPETGVLFEIHYPEKYNVFTRVNISYWEGKDFRTMLYKDFFKGKTVFNHWLPGMCYSNITFQLVSEATFNKSTLVEYS
Sequence Similarities : Belongs to the protein-tyrosine phosphatase family. Receptor class 3 subfamily.Contains 8 fibronectin type-III domains.Contains 1 tyrosine-protein phosphatase domain.
Gene Name PTPRO protein tyrosine phosphatase, receptor type, O [ Homo sapiens ]
Official Symbol PTPRO
Synonyms PTPRO; protein tyrosine phosphatase, receptor type, O; receptor-type tyrosine-protein phosphatase O; GLEPP1; NPHS6; osteoclastic transmembrane protein tyrosine phosphatase; PTP oc; PTP U2; PTPU2;
Gene ID 5800
mRNA Refseq NM_002848
Protein Refseq NP_002839
MIM 600579
Uniprot ID Q16827
Chromosome Location 12p13-p12
Pathway Signaling events mediated by Stem cell factor receptor (c-Kit), organism-specific biosystem;
Function hydrolase activity; protein binding; protein tyrosine phosphatase activity; protein tyrosine phosphatase activity; protein tyrosine phosphatase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTPRO Products

Required fields are marked with *

My Review for All PTPRO Products

Required fields are marked with *

0
cart-icon
0
compare icon