Recombinant Human PTPRO
| Cat.No. : | PTPRO-28582TH | 
| Product Overview : | Recombinant fragment of Human GLEPP1 with N-terminal proprietary tag.Mol Wt 36.52 kDa inclusive of tag. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | Non | 
| Protein Length : | 180 amino acids | 
| Description : | This gene encodes a member of the R3 subtype family of receptor-type protein tyrosine phosphatases. These proteins are localized to the apical surface of polarized cells and may have tissue-specific functions through activation of Src family kinases. This gene contains two distinct promoters, and alternatively spliced transcript variants encoding multiple isoforms have been observed. The encoded proteins may have multiple isoform-specific and tissue-specific functions, including the regulation of osteoclast production and activity, inhibition of cell proliferation and facilitation of apoptosis. This gene is a candidate tumor suppressor, and decreased expression of this gene has been observed in several types of cancer. | 
| Molecular Weight : | 36.520kDa inclusive of tags | 
| Tissue specificity : | Glomerulus of kidney. Also detected in brain, lung and placenta. | 
| Form : | Liquid | 
| Purity : | Proprietary Purification | 
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl | 
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | SITVLTKPLPVTSVSIYDYKPSPETGVLFEIHYPEKYNVFTRVNISYWEGKDFRTMLYKDFFKGKTVFNHWLPGMCYSNITFQLVSEATFNKSTLVEYS | 
| Sequence Similarities : | Belongs to the protein-tyrosine phosphatase family. Receptor class 3 subfamily.Contains 8 fibronectin type-III domains.Contains 1 tyrosine-protein phosphatase domain. | 
| Gene Name | PTPRO protein tyrosine phosphatase, receptor type, O [ Homo sapiens ] | 
| Official Symbol | PTPRO | 
| Synonyms | PTPRO; protein tyrosine phosphatase, receptor type, O; receptor-type tyrosine-protein phosphatase O; GLEPP1; NPHS6; osteoclastic transmembrane protein tyrosine phosphatase; PTP oc; PTP U2; PTPU2; | 
| Gene ID | 5800 | 
| mRNA Refseq | NM_002848 | 
| Protein Refseq | NP_002839 | 
| MIM | 600579 | 
| Uniprot ID | Q16827 | 
| Chromosome Location | 12p13-p12 | 
| Pathway | Signaling events mediated by Stem cell factor receptor (c-Kit), organism-specific biosystem; | 
| Function | hydrolase activity; protein binding; protein tyrosine phosphatase activity; protein tyrosine phosphatase activity; protein tyrosine phosphatase activity; | 
| ◆ Recombinant Proteins | ||
| PTPRO-28853TH | Recombinant Human PTPRO | +Inquiry | 
| Ptpro-6812M | Recombinant Mouse Ptpro protein, His & T7-tagged | +Inquiry | 
| PTPRO-5698C | Recombinant Chicken PTPRO | +Inquiry | 
| PTPRO-7289M | Recombinant Mouse PTPRO Protein, His (Fc)-Avi-tagged | +Inquiry | 
| PTPRO-13704M | Recombinant Mouse PTPRO Protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| PTPRO-2673HCL | Recombinant Human PTPRO 293 Cell Lysate | +Inquiry | 
| PTPRO-2672HCL | Recombinant Human PTPRO 293 Cell Lysate | +Inquiry | 
| PTPRO-2674HCL | Recombinant Human PTPRO 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All PTPRO Products
Required fields are marked with *
My Review for All PTPRO Products
Required fields are marked with *
  
        
    
      
            