Recombinant Human PTPRZ1 protein, His-tagged
Cat.No. : | PTPRZ1-3393H |
Product Overview : | Recombinant Human PTPRZ1 protein(P23471)(36-300aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 36-300aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34.1 kDa |
AA Sequence : | IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PTPRZ1 protein tyrosine phosphatase, receptor-type, Z polypeptide 1 [ Homo sapiens ] |
Official Symbol | PTPRZ1 |
Synonyms | PTPRZ1; protein tyrosine phosphatase, receptor-type, Z polypeptide 1; PTPRZ, PTPZ; receptor-type tyrosine-protein phosphatase zeta; phosphacan; PTP18; RPTPB; R-PTP-zeta-2; receptor-type tyrosine phosphatase beta/zeta; protein-tyrosine phosphatase receptor type Z polypeptide 2; protein tyrosine phosphatase, receptor-type, zeta polypeptide 1; PTPZ; HPTPZ; PTPRZ; HPTPzeta; PTP-ZETA; RPTPbeta; |
Gene ID | 5803 |
mRNA Refseq | NM_001206838 |
Protein Refseq | NP_001193767 |
MIM | 176891 |
UniProt ID | P23471 |
◆ Recombinant Proteins | ||
Ptprz1-8110M | Recombinant Mouse Ptprz1 protein, His & T7-tagged | +Inquiry |
PTPRZ1-3684H | Recombinant Human PTPRZ1 protein, GST-tagged | +Inquiry |
PTPRZ1-4258C | Recombinant Chicken PTPRZ1 | +Inquiry |
PTPRZ1-4847R | Recombinant Rat PTPRZ1 Protein | +Inquiry |
PTPRZ1-756H | Recombinant Human PTPRZ1 Protein (36-300 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTPRZ1 Products
Required fields are marked with *
My Review for All PTPRZ1 Products
Required fields are marked with *
0
Inquiry Basket