Recombinant Human PTRH2 Protein, GST-tagged

Cat.No. : PTRH2-235H
Product Overview : Human Bit1 full-length ORF ( AAH06807, 1 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 45.43 kDa
AA Sequence : MPSKSLVMEYLAHPSTLGLAVGVACGMCLGWSLRVCFGMLPKSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PTRH2 peptidyl-tRNA hydrolase 2 [ Homo sapiens ]
Official Symbol PTRH2
Synonyms PTRH2; peptidyl-tRNA hydrolase 2; peptidyl-tRNA hydrolase 2, mitochondrial; Bcl 2 inhibitor of transcription; BIT1; CGI 147; PTH2; PTH 2; bcl-2 inhibitor of transcription 1; CGI-147; FLJ32471;
Gene ID 51651
mRNA Refseq NM_016077
Protein Refseq NP_057161
MIM 608625
UniProt ID Q9Y3E5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTRH2 Products

Required fields are marked with *

My Review for All PTRH2 Products

Required fields are marked with *

0
cart-icon
0
compare icon