Recombinant Human PTRH2 Protein, GST-tagged
| Cat.No. : | PTRH2-235H |
| Product Overview : | Human Bit1 full-length ORF ( AAH06807, 1 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 45.43 kDa |
| AA Sequence : | MPSKSLVMEYLAHPSTLGLAVGVACGMCLGWSLRVCFGMLPKSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | PTRH2 peptidyl-tRNA hydrolase 2 [ Homo sapiens ] |
| Official Symbol | PTRH2 |
| Synonyms | PTRH2; peptidyl-tRNA hydrolase 2; peptidyl-tRNA hydrolase 2, mitochondrial; Bcl 2 inhibitor of transcription; BIT1; CGI 147; PTH2; PTH 2; bcl-2 inhibitor of transcription 1; CGI-147; FLJ32471; |
| Gene ID | 51651 |
| mRNA Refseq | NM_016077 |
| Protein Refseq | NP_057161 |
| MIM | 608625 |
| UniProt ID | Q9Y3E5 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTRH2 Products
Required fields are marked with *
My Review for All PTRH2 Products
Required fields are marked with *




