Recombinant Human PTRH2 Protein, GST-tagged
Cat.No. : | PTRH2-235H |
Product Overview : | Human Bit1 full-length ORF ( AAH06807, 1 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 45.43 kDa |
AA Sequence : | MPSKSLVMEYLAHPSTLGLAVGVACGMCLGWSLRVCFGMLPKSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PTRH2 peptidyl-tRNA hydrolase 2 [ Homo sapiens ] |
Official Symbol | PTRH2 |
Synonyms | PTRH2; peptidyl-tRNA hydrolase 2; peptidyl-tRNA hydrolase 2, mitochondrial; Bcl 2 inhibitor of transcription; BIT1; CGI 147; PTH2; PTH 2; bcl-2 inhibitor of transcription 1; CGI-147; FLJ32471; |
Gene ID | 51651 |
mRNA Refseq | NM_016077 |
Protein Refseq | NP_057161 |
MIM | 608625 |
UniProt ID | Q9Y3E5 |
◆ Recombinant Proteins | ||
PTRH2-235H | Recombinant Human PTRH2 Protein, GST-tagged | +Inquiry |
PTRH2-335H | Recombinant Human PTRH2 protein, GST-tagged | +Inquiry |
PTRH2-3710R | Recombinant Rhesus monkey PTRH2 Protein, His-tagged | +Inquiry |
PTRH2-3370H | Recombinant Human Peptidyl-TRNA Hydrolase 2, 64-179 aa, His-tagged | +Inquiry |
PTRH2-31259TH | Recombinant Human PTRH2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTRH2-2669HCL | Recombinant Human PTRH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTRH2 Products
Required fields are marked with *
My Review for All PTRH2 Products
Required fields are marked with *
0
Inquiry Basket