Recombinant Human PTS Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PTS-5376H |
Product Overview : | PTS MS Standard C13 and N15-labeled recombinant protein (NP_000308) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The enzyme encoded by this gene catalyzes the elimination of inorganic triphosphate from dihydroneopterin triphosphate, which is the second and irreversible step in the biosynthesis of tetrahydrobiopterin from GTP. Tetrahydrobiopterin, also known as BH(4), is an essential cofactor and regulator of various enzyme activities, including enzymes involved in serotonin biosynthesis and NO synthase activity. Mutations in this gene result in hyperphenylalaninemia. |
Molecular Mass : | 16.4 kDa |
AA Sequence : | MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYMWDNLQKVLPVGVLYKVKVYETDNNIVVYKGETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PTS 6-pyruvoyltetrahydropterin synthase [ Homo sapiens (human) ] |
Official Symbol | PTS |
Synonyms | PTS; PTPS; 6-pyruvoyltetrahydropterin synthase; 6-pyruvoyl tetrahydrobiopterin synthase; PTP synthase; EC 4.2.3.12 |
Gene ID | 5805 |
mRNA Refseq | NM_000317 |
Protein Refseq | NP_000308 |
MIM | 612719 |
UniProt ID | Q03393 |
◆ Recombinant Proteins | ||
PTS-2067H | Recombinant Human PTS, GST-tagged | +Inquiry |
PTS-7296M | Recombinant Mouse PTS Protein, His (Fc)-Avi-tagged | +Inquiry |
PTS-3529R | Recombinant Rhesus Macaque PTS Protein, His (Fc)-Avi-tagged | +Inquiry |
PTS-3712R | Recombinant Rhesus monkey PTS Protein, His-tagged | +Inquiry |
PTS-498H | Recombinant Human Pts, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTS-2668HCL | Recombinant Human PTS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTS Products
Required fields are marked with *
My Review for All PTS Products
Required fields are marked with *
0
Inquiry Basket