Recombinant Human PUSL1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | PUSL1-3805H |
| Product Overview : | PUSL1 MS Standard C13 and N15-labeled recombinant protein (NP_699170) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | PUSL1 (Pseudouridine Synthase Like 1) is a Protein Coding gene. Diseases associated with PUSL1 include Myopathy, Lactic Acidosis, And Sideroblastic Anemia. Gene Ontology (GO) annotations related to this gene include RNA binding and pseudouridine synthase activity. An important paralog of this gene is PUS3. |
| Molecular Mass : | 33.2 kDa |
| AA Sequence : | MSSAPASGSVRARYLVYFQYVGTDFNGVAAVRGTQRAVGVQNYLEEAAERLNSVEPVRFTISSRTDAGVHALSNAAHLDVQRRSGRPPFPPEVLAEALNTHLRHPAIRVLRAFRVPSDFHARHAATSRTYLYRLATGCHRRDELPVFERNLCWTLPADCLDMVAMQEAAQHLLGTHDFSAFQSAGSPVPSPVRTLRRVSVSPGQASPLVTPEESRKLRFWNLEFESQSFLYRQVRRMTAVLVAVGLGALAPAQVKTILESQDPLGKHQTRVAPAHGLFLKSVLYGNLGAASCTLQGPQFGSHGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | PUSL1 pseudouridylate synthase-like 1 [ Homo sapiens (human) ] |
| Official Symbol | PUSL1 |
| Synonyms | PUSL1; pseudouridylate synthase-like 1; tRNA pseudouridine synthase-like 1; FLJ90811; tRNA-uridine isomerase-like 1; tRNA pseudouridylate synthase-like 1; |
| Gene ID | 126789 |
| mRNA Refseq | NM_153339 |
| Protein Refseq | NP_699170 |
| UniProt ID | Q8N0Z8 |
| ◆ Recombinant Proteins | ||
| PUSL1-5225C | Recombinant Chicken PUSL1 | +Inquiry |
| PUSL1-586HF | Recombinant Full Length Human PUSL1 Protein, GST-tagged | +Inquiry |
| PUSL1-5224C | Recombinant Chicken PUSL1 | +Inquiry |
| PUSL1-4118HFL | Recombinant Full Length Human PUSL1 protein, Flag-tagged | +Inquiry |
| PUSL1-2077H | Recombinant Human PUSL1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PUSL1-2659HCL | Recombinant Human PUSL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PUSL1 Products
Required fields are marked with *
My Review for All PUSL1 Products
Required fields are marked with *
