Recombinant Human PVALB protein, His-SUMO-tagged
| Cat.No. : | PVALB-3394H |
| Product Overview : | Recombinant Human PVALB protein(P20472)(2-110aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 2-110aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 27.9 kDa |
| AA Sequence : | SMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | PVALB parvalbumin [ Homo sapiens ] |
| Official Symbol | PVALB |
| Synonyms | PVALB; parvalbumin; parvalbumin alpha; D22S749; MGC116759; |
| Gene ID | 5816 |
| mRNA Refseq | NM_002854 |
| Protein Refseq | NP_002845 |
| MIM | 168890 |
| UniProt ID | P20472 |
| ◆ Recombinant Proteins | ||
| PVALB-6119H | Recombinant Human PVALB Protein (Met1-Ser110), N-His tagged | +Inquiry |
| PVALB-4510R | Recombinant Rat PVALB Protein, His (Fc)-Avi-tagged | +Inquiry |
| PVALB-427H | Recombinant Human Parvalbumin / PVALB Protein | +Inquiry |
| PVALB-13729M | Recombinant Mouse PVALB Protein | +Inquiry |
| PVALB-4851R | Recombinant Rat PVALB Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PVALB-2658HCL | Recombinant Human PVALB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PVALB Products
Required fields are marked with *
My Review for All PVALB Products
Required fields are marked with *



