Recombinant Human PVALB protein, His-SUMO-tagged
Cat.No. : | PVALB-3394H |
Product Overview : | Recombinant Human PVALB protein(P20472)(2-110aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-110aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27.9 kDa |
AA Sequence : | SMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PVALB parvalbumin [ Homo sapiens ] |
Official Symbol | PVALB |
Synonyms | PVALB; parvalbumin; parvalbumin alpha; D22S749; MGC116759; |
Gene ID | 5816 |
mRNA Refseq | NM_002854 |
Protein Refseq | NP_002845 |
MIM | 168890 |
UniProt ID | P20472 |
◆ Recombinant Proteins | ||
PVALB-6119H | Recombinant Human PVALB Protein (Met1-Ser110), N-His tagged | +Inquiry |
PVALB-7744H | Recombinant Human PVALB protein | +Inquiry |
Pvalb-254R | Recombinant Full Length Rat Parvalbumin / PVALB Protein | +Inquiry |
PVALB-29530TH | Recombinant Human PVALB, His-tagged | +Inquiry |
PVALB-6118H | Recombinant Human PVALB Protein (Ser2-Ser110), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PVALB-2658HCL | Recombinant Human PVALB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PVALB Products
Required fields are marked with *
My Review for All PVALB Products
Required fields are marked with *
0
Inquiry Basket