Recombinant Human PVRIG protein, GST-tagged
Cat.No. : | PVRIG-32H |
Product Overview : | Recombinant Human PVRIG(38 a.a. - 326 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 38-326 a.a. |
Description : | PVRIG played an important role in many functions. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 57.53 kDa |
AA Sequence : | TAGTPEVWVQVRMEATELSSFTIRCGFLGSGSISLVTVSWGGPDGAGGTTLAVLHPERGIRQWAPARQARWETQS SISLILEGSGASSPCANTTFCCKFASFPEGSWEACGSLPPSSDPGLSAPPTPAPILRADLAGILGVSGVLLFGCV YLLHLLRRHKHRPAPRLQPSRTSPQAPRARAWAPSQASQAALHVPYATINTSCRPATLDTAHPHGGPSWWAPLPT HAAHRPQGPAAWASTPIPARGSFVSVENGLYAQAGERPPHTGPGLTLFPDPRGPRAMEGPLGVR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | PVRIG poliovirus receptor related immunoglobulin domain containing [ Homo sapiens ] |
Official Symbol | PVRIG |
Synonyms | PVRIG; poliovirus receptor related immunoglobulin domain containing; transmembrane protein PVRIG; C7orf15; MGC2463; poliovirus receptor-related immunoglobulin domain-containing protein; MGC104322; MGC138295; MGC138297; |
Gene ID | 79037 |
mRNA Refseq | NM_024070 |
Protein Refseq | NP_076975 |
MIM | |
UniProt ID | Q6DKI7 |
Chromosome Location | 7q22 |
◆ Recombinant Proteins | ||
PVRIG-235C | Active Recombinant Cynomolgus/Rhesus PVRIG Protein, His-tagged | +Inquiry |
PVRIG-2164C | Active Recombinant Cynomolgus PVRIG protein, mFc-tagged | +Inquiry |
PVRIG-522H | Active Recombinant Human PVRIG protein(Thr41-Leu172), hFc-tagged | +Inquiry |
PVRIG-1387H | Acitve Recombinant Human PVRIG protein(Thr41-Leu172), mFc-tagged | +Inquiry |
PVRIG-1680M | Recombinant Mouse PVRIG protein, hFc-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PVRIG-1447HCL | Recombinant Human PVRIG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PVRIG Products
Required fields are marked with *
My Review for All PVRIG Products
Required fields are marked with *