Recombinant Human PVRIG protein, GST-tagged
| Cat.No. : | PVRIG-32H |
| Product Overview : | Recombinant Human PVRIG(38 a.a. - 326 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 38-326 a.a. |
| Description : | PVRIG played an important role in many functions. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 57.53 kDa |
| AA Sequence : | TAGTPEVWVQVRMEATELSSFTIRCGFLGSGSISLVTVSWGGPDGAGGTTLAVLHPERGIRQWAPARQARWETQS SISLILEGSGASSPCANTTFCCKFASFPEGSWEACGSLPPSSDPGLSAPPTPAPILRADLAGILGVSGVLLFGCV YLLHLLRRHKHRPAPRLQPSRTSPQAPRARAWAPSQASQAALHVPYATINTSCRPATLDTAHPHGGPSWWAPLPT HAAHRPQGPAAWASTPIPARGSFVSVENGLYAQAGERPPHTGPGLTLFPDPRGPRAMEGPLGVR |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | PVRIG poliovirus receptor related immunoglobulin domain containing [ Homo sapiens ] |
| Official Symbol | PVRIG |
| Synonyms | PVRIG; poliovirus receptor related immunoglobulin domain containing; transmembrane protein PVRIG; C7orf15; MGC2463; poliovirus receptor-related immunoglobulin domain-containing protein; MGC104322; MGC138295; MGC138297; |
| Gene ID | 79037 |
| mRNA Refseq | NM_024070 |
| Protein Refseq | NP_076975 |
| MIM | |
| UniProt ID | Q6DKI7 |
| Chromosome Location | 7q22 |
| ◆ Recombinant Proteins | ||
| PVRIG-3951H | Recombinant Human PVRIG Protein, His (Fc)-Avi-tagged | +Inquiry |
| PVRIG-2079H | Recombinant Human PVRIG, His-tagged | +Inquiry |
| PVRIG-36H | Recombinant Human PVRIG Full Length Transmembrane protein, His/SUMO-tagged | +Inquiry |
| PVRIG-390H | Recombinant Human PVRIG protein, mFc-tagged | +Inquiry |
| PVRIG-0603M | Recombinant Mouse PVRIG protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PVRIG-1447HCL | Recombinant Human PVRIG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PVRIG Products
Required fields are marked with *
My Review for All PVRIG Products
Required fields are marked with *
