"PVRL1" Related Products

Expand

Recombinant Human PVRL1 protein, T7/His-tagged

Cat.No.: PVRL1-106H
Product Overview: Recombinant human CD111 extracellular domain cDNA (31-355aa, Isoform-1, derived from BC104948) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQN VAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTVMAKPTNWIEG TQAVLRAKKGQDDKVLVATCTSANGKPPSVVSWETRLKGEAEYQEIRNPNGTVTVISRYRLVPSREAHQQSLACI VNYHMDRFKESLTLNVQYEPEVTIEGFDGNWYLQRMDVKLTCKADANPPATEYHWTTLNGSLPKGVEAQNRTLFF KGPINYSLAGTYICEATNPIGTRSGQVEVNITEFPYTPSPPEHGRRAGPVPTA
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro cell receptors interaction for epithelial, endothelial and neuronal differentiation regulations study with this protein as coating matrix protein.2. May be used for CD111 protein-protein interaction assay3. May be used for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: PVRL1 poliovirus receptor-related 1 (herpesvirus entry mediator C) [ Homo sapiens ]
Official Symbol: PVRL1
Synonyms: PVRL1; poliovirus receptor-related 1 (herpesvirus entry mediator C); ED4, HVEC; poliovirus receptor-related protein 1; CD111; CLPED1; HIgR; nectin; OFC7; PRR; PRR1; PVRR1; SK 12; nectin 1; poliovirus receptor-like 1; herpesvirus Ig-like receptor; herpes v
Gene ID: 5818
mRNA Refseq: NM_002855
Protein Refseq: NP_002846
MIM: 600644
UniProt ID: Q15223
Chromosome Location: 11q23-q24
Pathway: Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Adherens junctions interactions, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem;
Function: carbohydrate binding; cell adhesion molecule binding; coreceptor activity; protein binding; protein heterodimerization activity; protein homodimerization activity; receptor activity; virion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.