Recombinant Human PVRL1 protein, T7/His-tagged
Cat.No. : | PVRL1-106H |
Product Overview : | Recombinant human CD111 extracellular domain cDNA (31-355aa, Isoform-1, derived from BC104948) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 31-355 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQN VAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTVMAKPTNWIEG TQAVLRAKKGQDDKVLVATCTSANGKPPSVVSWETRLKGEAEYQEIRNPNGTVTVISRYRLVPSREAHQQSLACI VNYHMDRFKESLTLNVQYEPEVTIEGFDGNWYLQRMDVKLTCKADANPPATEYHWTTLNGSLPKGVEAQNRTLFF KGPINYSLAGTYICEATNPIGTRSGQVEVNITEFPYTPSPPEHGRRAGPVPTA |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro cell receptors interaction for epithelial, endothelial and neuronal differentiation regulations study with this protein as coating matrix protein.2. May be used for CD111 protein-protein interaction assay3. May be used for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | PVRL1 poliovirus receptor-related 1 (herpesvirus entry mediator C) [ Homo sapiens ] |
Official Symbol | PVRL1 |
Synonyms | PVRL1; poliovirus receptor-related 1 (herpesvirus entry mediator C); ED4, HVEC; poliovirus receptor-related protein 1; CD111; CLPED1; HIgR; nectin; OFC7; PRR; PRR1; PVRR1; SK 12; nectin 1; poliovirus receptor-like 1; herpesvirus Ig-like receptor; herpes v |
Gene ID | 5818 |
mRNA Refseq | NM_002855 |
Protein Refseq | NP_002846 |
MIM | 600644 |
UniProt ID | Q15223 |
Chromosome Location | 11q23-q24 |
Pathway | Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Adherens junctions interactions, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; |
Function | carbohydrate binding; cell adhesion molecule binding; coreceptor activity; protein binding; protein heterodimerization activity; protein homodimerization activity; receptor activity; virion binding; |
◆ Recombinant Proteins | ||
PVRL1-3045H | Recombinant Human PVRL1 protein, His-tagged | +Inquiry |
PVRL1-3217H | Active Recombinant Human PVRL1 protein, His-tagged | +Inquiry |
Pvrl1-7473R | Recombinant Rat Pvrl1 protein, His-tagged | +Inquiry |
Pvrl1-7472R | Recombinant Rat Pvrl1, Fc tagged | +Inquiry |
PVRL1-276H | Recombinant Human PVRL1 Protein (ECD), His-tagged(C-ter) | +Inquiry |
◆ Cell & Tissue Lysates | ||
PVRL1-2299HCL | Recombinant Human PVRL1 cell lysate | +Inquiry |
PVRL1-1409RCL | Recombinant Rat PVRL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PVRL1 Products
Required fields are marked with *
My Review for All PVRL1 Products
Required fields are marked with *
0
Inquiry Basket