Recombinant Human PXMP2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PXMP2-735H
Product Overview : PXMP2 MS Standard C13 and N15-labeled recombinant protein (NP_061133) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Seems to be involved in pore-forming activity and may contribute to the unspecific permeability of the peroxisomal membrane.
Molecular Mass : 22.3 kDa
AA Sequence : MAPAASRLRAEAGLGALPRRALAQYLLFLRLYPVLTKAATSGILSALGNFLAQMIEKKRKKENSRSLDVGGPLRYAVYGFFFTGPLSHFFYFFMEHWIPPEVPLAGLRRLLLDRLVFAPAFLMLFFLIMNFLEGKDASAFAAKMRGGFWPALRMNWRVWTPLQFININYVPLKFRVLFANLAALFWYAYLASLGKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PXMP2 peroxisomal membrane protein 2 [ Homo sapiens (human) ]
Official Symbol PXMP2
Synonyms PXMP2; peroxisomal membrane protein 2, 22kDa; peroxisomal membrane protein 2 (22kD); peroxisomal membrane protein 2; PMP22; 22 kDa peroxisomal membrane protein; FLJ54922;
Gene ID 5827
mRNA Refseq NM_018663
Protein Refseq NP_061133
MIM 617399
UniProt ID Q9NR77

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PXMP2 Products

Required fields are marked with *

My Review for All PXMP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon