Recombinant Human PXMP2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | PXMP2-735H |
| Product Overview : | PXMP2 MS Standard C13 and N15-labeled recombinant protein (NP_061133) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Seems to be involved in pore-forming activity and may contribute to the unspecific permeability of the peroxisomal membrane. |
| Molecular Mass : | 22.3 kDa |
| AA Sequence : | MAPAASRLRAEAGLGALPRRALAQYLLFLRLYPVLTKAATSGILSALGNFLAQMIEKKRKKENSRSLDVGGPLRYAVYGFFFTGPLSHFFYFFMEHWIPPEVPLAGLRRLLLDRLVFAPAFLMLFFLIMNFLEGKDASAFAAKMRGGFWPALRMNWRVWTPLQFININYVPLKFRVLFANLAALFWYAYLASLGKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | PXMP2 peroxisomal membrane protein 2 [ Homo sapiens (human) ] |
| Official Symbol | PXMP2 |
| Synonyms | PXMP2; peroxisomal membrane protein 2, 22kDa; peroxisomal membrane protein 2 (22kD); peroxisomal membrane protein 2; PMP22; 22 kDa peroxisomal membrane protein; FLJ54922; |
| Gene ID | 5827 |
| mRNA Refseq | NM_018663 |
| Protein Refseq | NP_061133 |
| MIM | 617399 |
| UniProt ID | Q9NR77 |
| ◆ Cell & Tissue Lysates | ||
| PXMP2-2652HCL | Recombinant Human PXMP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PXMP2 Products
Required fields are marked with *
My Review for All PXMP2 Products
Required fields are marked with *
