Recombinant Human PYCR1 protein, His-tagged

• Cat.No.: PYCR1-5744H
• Product Overview: Recombinant Human PYCR1 protein(14-148 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 14-148 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: ALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQVEDGRL
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: PYCR1 pyrroline-5-carboxylate reductase 1 [ Homo sapiens ]
• Official Symbol: PYCR1
• Synonyms: PYCR1; pyrroline-5-carboxylate reductase 1; pyrroline-5-carboxylate reductase 1, mitochondrial; P5C; P5CR 1; P5C reductase 1; proliferation-inducing protein 45; mitochondrial pyrroline-5-carboxylate reductase 1; P5CR; PRO3; PYCR; PIG45; PP222; ARCL2B; ARCL3B
• Gene ID: 5831
• mRNA Refseq: NM_006907
• Protein Refseq: NP_008838
• MIM: 179035
• UniProt ID: P32322