Recombinant Human PYCR3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PYCR3-3613H
• Product Overview: PYCRL MS Standard C13 and N15-labeled recombinant protein (NP_075566) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a protein that belongs to the pyrroline-5-carboxylate reductase family of enzymes. Members of this family catalyze the final step in proline biosynthesis, converting pyrroline-5-carboxylate to proline. Glutamate and ornithine are precursors in the synthesis of proline. The protein encoded by this gene is a cytoplasmic enzyme involved in the biosynthesis of proline from ornithine.
• Molecular Mass: 28.6 kDa
• AA Sequence: MAAAEPSPRRVGFVGAGRMAGAIAQGLIRAGKVEAQHILASAPTDRNLCHFQALGCRTTHSNQEVLQSCLLVIFATKPHVLPAVLAEVAPVVTTEHILVSVAAGVSLSTLEELLPPNTRVLRVLPNLPCVVQEGAIVMARGRHVGSSETNLLQHLLEACGRCEEVPEAYVDIHTGLSGSGVAFVCAFSEALAEGAVKMGMPSSLAHRIAAQTLLGTAKMLLHEGQHPAQLRSDVCTPGGTTIYGLHALEQGGLRAATMSAVEAATCRAKELSRKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PYCR3 pyrroline-5-carboxylate reductase 3 [ Homo sapiens (human) ]
• Official Symbol: PYCR3
• Synonyms: PYCR3; pyrroline-5-carboxylate reductase 3; PYCRL; pyrroline-5-carboxylate reductase 3; P5C reductase 3; P5CR 3; pyrroline-5-carboxylate reductase-like; EC 1.5.1.2
• Gene ID: 65263
• mRNA Refseq: NM_023078
• Protein Refseq: NP_075566
• MIM: 616408
• UniProt ID: Q53H96