Recombinant Human PYCR3 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | PYCR3-3613H |
| Product Overview : | PYCRL MS Standard C13 and N15-labeled recombinant protein (NP_075566) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a protein that belongs to the pyrroline-5-carboxylate reductase family of enzymes. Members of this family catalyze the final step in proline biosynthesis, converting pyrroline-5-carboxylate to proline. Glutamate and ornithine are precursors in the synthesis of proline. The protein encoded by this gene is a cytoplasmic enzyme involved in the biosynthesis of proline from ornithine. |
| Molecular Mass : | 28.6 kDa |
| AA Sequence : | MAAAEPSPRRVGFVGAGRMAGAIAQGLIRAGKVEAQHILASAPTDRNLCHFQALGCRTTHSNQEVLQSCLLVIFATKPHVLPAVLAEVAPVVTTEHILVSVAAGVSLSTLEELLPPNTRVLRVLPNLPCVVQEGAIVMARGRHVGSSETNLLQHLLEACGRCEEVPEAYVDIHTGLSGSGVAFVCAFSEALAEGAVKMGMPSSLAHRIAAQTLLGTAKMLLHEGQHPAQLRSDVCTPGGTTIYGLHALEQGGLRAATMSAVEAATCRAKELSRKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | PYCR3 pyrroline-5-carboxylate reductase 3 [ Homo sapiens (human) ] |
| Official Symbol | PYCR3 |
| Synonyms | PYCR3; pyrroline-5-carboxylate reductase 3; PYCRL; pyrroline-5-carboxylate reductase 3; P5C reductase 3; P5CR 3; pyrroline-5-carboxylate reductase-like; EC 1.5.1.2 |
| Gene ID | 65263 |
| mRNA Refseq | NM_023078 |
| Protein Refseq | NP_075566 |
| MIM | 616408 |
| UniProt ID | Q53H96 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PYCR3 Products
Required fields are marked with *
My Review for All PYCR3 Products
Required fields are marked with *



