Recombinant Human PYCR3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PYCR3-3613H
Product Overview : PYCRL MS Standard C13 and N15-labeled recombinant protein (NP_075566) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a protein that belongs to the pyrroline-5-carboxylate reductase family of enzymes. Members of this family catalyze the final step in proline biosynthesis, converting pyrroline-5-carboxylate to proline. Glutamate and ornithine are precursors in the synthesis of proline. The protein encoded by this gene is a cytoplasmic enzyme involved in the biosynthesis of proline from ornithine.
Molecular Mass : 28.6 kDa
AA Sequence : MAAAEPSPRRVGFVGAGRMAGAIAQGLIRAGKVEAQHILASAPTDRNLCHFQALGCRTTHSNQEVLQSCLLVIFATKPHVLPAVLAEVAPVVTTEHILVSVAAGVSLSTLEELLPPNTRVLRVLPNLPCVVQEGAIVMARGRHVGSSETNLLQHLLEACGRCEEVPEAYVDIHTGLSGSGVAFVCAFSEALAEGAVKMGMPSSLAHRIAAQTLLGTAKMLLHEGQHPAQLRSDVCTPGGTTIYGLHALEQGGLRAATMSAVEAATCRAKELSRKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PYCR3 pyrroline-5-carboxylate reductase 3 [ Homo sapiens (human) ]
Official Symbol PYCR3
Synonyms PYCR3; pyrroline-5-carboxylate reductase 3; PYCRL; pyrroline-5-carboxylate reductase 3; P5C reductase 3; P5CR 3; pyrroline-5-carboxylate reductase-like; EC 1.5.1.2
Gene ID 65263
mRNA Refseq NM_023078
Protein Refseq NP_075566
MIM 616408
UniProt ID Q53H96

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PYCR3 Products

Required fields are marked with *

My Review for All PYCR3 Products

Required fields are marked with *

0
cart-icon
0
compare icon