Recombinant Human PYDC1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PYDC1-3607H
• Product Overview: PYDC1 MS Standard C13 and N15-labeled recombinant protein (NP_690865) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Associates with PYCARD/ASC and modulates its ability to collaborate with MEFV/pyrin and NLRP3/cryopyrin in NF-kappa-B and pro-caspase-1 activation. Suppresses kinase activity of NF-kappa-B inhibitor kinase (IKK) complex, expression of NF-kappa-B inducible genes and inhibits NF-kappa-B activation by cytokines and LPS.
• Molecular Mass: 10.1 kDa
• AA Sequence: MGTKREAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTDKLVASYYEDYAAELVVAVLRDMRMLEEAARLQRAATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PYDC1 pyrin domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: PYDC1
• Synonyms: PYDC1; PYD (pyrin domain) containing 1; pyrin domain containing 1; pyrin domain-containing protein 1; ASC2; POP1; PAAD-only protein 1; pyrin-only protein 1; pyrin-domain containing protein 1; PYC1
• Gene ID: 260434
• mRNA Refseq: NM_152901
• Protein Refseq: NP_690865
• MIM: 615700
• UniProt ID: Q8WXC3