Recombinant Human PYROXD2 protein, His-tagged
Cat.No. : | PYROXD2-4633H |
Product Overview : | Recombinant Human PYROXD2 protein(232-581 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 232-581 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | DQWFESEPLKATLATDAVIGAMTSPHTPGSGYVLLHHVMGGLEGMQGAWGYVQGGMGALSDAIASSATTHGASIFTEKTVAKVQVNSEGCVQGVVLEDGTEVRSKMVLSNTSPQITFLKLTPQEWLPEEFLERISQLDTRSPVTKINVAVDRLPSFLAAPNAPRGQPLPHHQCSIHLNCEDTLLLHQAFEDAMDGLSSHRPVIELCIPSSLDPTLAPPGCHVVSLFTQYTPYTLAGGKAWDEQERDAYADRVFDCIEVYAPGFKDSVVGRDILTPPDLERIFGLPGGNIFHCAMSLDQLYFARPVPLHSGYRCPLQGLYLCGSGAHPGGGVMGAAGRNAAHVAFRDLKSM |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | PYROXD2 pyridine nucleotide-disulphide oxidoreductase domain 2 [ Homo sapiens ] |
Official Symbol | PYROXD2 |
Synonyms | PYROXD2; pyridine nucleotide-disulphide oxidoreductase domain 2; C10orf33, chromosome 10 open reading frame 33; pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2; FLJ23849; FP3420; C10orf33; FLJ12197; MGC13047; |
Gene ID | 84795 |
mRNA Refseq | NM_032709 |
Protein Refseq | NP_116098 |
UniProt ID | Q8N2H3 |
◆ Recombinant Proteins | ||
PYROXD2-3724R | Recombinant Rhesus monkey PYROXD2 Protein, His-tagged | +Inquiry |
PYROXD2-1314H | Recombinant Human PYROXD2 | +Inquiry |
PYROXD2-3541R | Recombinant Rhesus Macaque PYROXD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PYROXD2-4633H | Recombinant Human PYROXD2 protein, His-tagged | +Inquiry |
PYROXD2-4861R | Recombinant Rat PYROXD2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PYROXD2 Products
Required fields are marked with *
My Review for All PYROXD2 Products
Required fields are marked with *