Recombinant Human PYY protein, His-tagged
| Cat.No. : | PYY-3398H |
| Product Overview : | Recombinant Human PYY protein(P10082)(31-64aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 31-64aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 8.1 kDa |
| AA Sequence : | IKPEAPREDASPEELNRYYASLRHYLNLVTRQRY |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | PYY peptide YY [ Homo sapiens ] |
| Official Symbol | PYY |
| Synonyms | PYY; peptide YY; PYY1; PYY-I; peptide tyrosine tyrosine; |
| Gene ID | 5697 |
| mRNA Refseq | NM_004160 |
| Protein Refseq | NP_004151 |
| UniProt ID | P10082 |
| ◆ Recombinant Proteins | ||
| PYY-4811M | Recombinant Mouse PYY Protein, His-tagged | +Inquiry |
| Pyy-5276M | Recombinant Full Length Mouse Pyy Protein, Myc/DDK-tagged | +Inquiry |
| Pyy-4564M | Recombinant Mouse Pyy protein, GST-tagged | +Inquiry |
| PYY-371H | Recombinant Human PYY protein, GST-tagged | +Inquiry |
| PYY-2831H | Recombinant Human PYY Protein, His-tagged, OVA Conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PYY-2641HCL | Recombinant Human PYY 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PYY Products
Required fields are marked with *
My Review for All PYY Products
Required fields are marked with *
