Recombinant Human QPCTL Protein (212-382 aa), His-SUMO-tagged

Cat.No. : QPCTL-1126H
Product Overview : Recombinant Human QPCTL Protein (212-382 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 212-382 aa
Description : Responsible for the biosynthesis of pyroglutamyl peptides.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 35.5 kDa
AA Sequence : AAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name QPCTL glutaminyl-peptide cyclotransferase-like [ Homo sapiens ]
Official Symbol QPCTL
Synonyms QPCTL; FLJ20084; isoQC; gQC;
Gene ID 54814
mRNA Refseq NM_001163377
Protein Refseq NP_001156849
UniProt ID Q9NXS2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All QPCTL Products

Required fields are marked with *

My Review for All QPCTL Products

Required fields are marked with *

0
cart-icon
0
compare icon