Recombinant Human QPCTL protein, GST-tagged
Cat.No. : | QPCTL-16H |
Product Overview : | Recombinant Human QPCTL(1 a.a. - 288 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-288 a.a. |
Description : | QPCTL played an important role in many functions. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 59.3 kDa |
AA Sequence : | MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLIGS LPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLA QLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGE PFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | QPCTL glutaminyl-peptide cyclotransferase-like [ Homo sapiens ] |
Official Symbol | QPCTL |
Synonyms | QPCTL; glutaminyl-peptide cyclotransferase-like; glutaminyl-peptide cyclotransferase-like protein; FLJ20084; glutaminyl cyclase like; isoQC; glutaminyl cyclase-like; golgi-resident glutaminyl-peptide cyclotransferase; gQC; |
Gene ID | 54814 |
mRNA Refseq | NM_001163377 |
Protein Refseq | NP_001156849 |
MIM | |
UniProt ID | Q9NXS2 |
Chromosome Location | 19q13.32 |
Function | glutaminyl-peptide cyclotransferase activity; metal ion binding; peptidase activity; transferase activity, transferring acyl groups; zinc ion binding; |
◆ Recombinant Proteins | ||
QPCTL-13763M | Recombinant Mouse QPCTL Protein | +Inquiry |
QPCTL-5951H | Recombinant Human QPCTL Protein (Ser53-Leu382), N-His tagged | +Inquiry |
RFL6303MF | Recombinant Full Length Macaca Fascicularis Glutaminyl-Peptide Cyclotransferase-Like Protein(Qpctl) Protein, His-Tagged | +Inquiry |
QPCTL-3543R | Recombinant Rhesus Macaque QPCTL Protein, His (Fc)-Avi-tagged | +Inquiry |
QPCTL-2092H | Recombinant Human QPCTL, GST-tagged | +Inquiry |
◆ Native Proteins | ||
QPCTL-7323M | Recombinant Mouse QPCTL Protein, His-Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
QPCTL-2133HCL | Recombinant Human QPCTL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All QPCTL Products
Required fields are marked with *
My Review for All QPCTL Products
Required fields are marked with *