Recombinant Human QPCTL protein, GST-tagged

• Cat.No.: QPCTL-16H
• Product Overview: Recombinant Human QPCTL(1 a.a. - 288 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-288 a.a.
• Description: QPCTL played an important role in many functions.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 59.3 kDa
• AA Sequence: MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLIGS LPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLA QLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGE PFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: QPCTL glutaminyl-peptide cyclotransferase-like [ Homo sapiens ]
• Official Symbol: QPCTL
• Synonyms: QPCTL; glutaminyl-peptide cyclotransferase-like; glutaminyl-peptide cyclotransferase-like protein; FLJ20084; glutaminyl cyclase like; isoQC; glutaminyl cyclase-like; golgi-resident glutaminyl-peptide cyclotransferase; gQC
• Gene ID: 54814
• mRNA Refseq: NM_001163377
• Protein Refseq: NP_001156849
• UniProt ID: Q9NXS2
• Chromosome Location: 19q13.32
• Function: glutaminyl-peptide cyclotransferase activity; metal ion binding; peptidase activity; transferase activity, transferring acyl groups; zinc ion binding