Recombinant Human QPCTL protein, GST-tagged
| Cat.No. : | QPCTL-16H |
| Product Overview : | Recombinant Human QPCTL(1 a.a. - 288 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-288 a.a. |
| Description : | QPCTL played an important role in many functions. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 59.3 kDa |
| AA Sequence : | MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLIGS LPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLA QLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGE PFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | QPCTL glutaminyl-peptide cyclotransferase-like [ Homo sapiens ] |
| Official Symbol | QPCTL |
| Synonyms | QPCTL; glutaminyl-peptide cyclotransferase-like; glutaminyl-peptide cyclotransferase-like protein; FLJ20084; glutaminyl cyclase like; isoQC; glutaminyl cyclase-like; golgi-resident glutaminyl-peptide cyclotransferase; gQC; |
| Gene ID | 54814 |
| mRNA Refseq | NM_001163377 |
| Protein Refseq | NP_001156849 |
| MIM | |
| UniProt ID | Q9NXS2 |
| Chromosome Location | 19q13.32 |
| Function | glutaminyl-peptide cyclotransferase activity; metal ion binding; peptidase activity; transferase activity, transferring acyl groups; zinc ion binding; |
| ◆ Cell & Tissue Lysates | ||
| QPCTL-2133HCL | Recombinant Human QPCTL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All QPCTL Products
Required fields are marked with *
My Review for All QPCTL Products
Required fields are marked with *
