Recombinant Mouse QPCTL Protein, His-Avi-tagged, Biotinylated
| Cat.No. : | QPCTL-7323M |
| Product Overview : | Biotinylated recombinant Mouse QPCTL Protein with His-Avi tag was expressed in HEK293. |
| Availability | December 13, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | HEK293 |
| Tag : | Avi&His |
| Protein Length : | 60-383 aa |
| Description : | Predicted to enable glutaminyl-peptide cyclotransferase activity and zinc ion binding activity. Predicted to be located in Golgi apparatus. Orthologous to human QPCTL (glutaminyl-peptide cyclotransferase like). |
| Molecular Mass : | 39 kDa |
| AASequence : | HHHHHHHHGSGLNDIFEAQKIEWHEVEEMSRSRDLRVPLIGSLSEAKLRLVVGQLDPQRLWGTFLRPLLIVRPPGSSGNLQVRKFLEATLQSLSAGWHVELDPFTASTPLGPLDFGNVVATLDPGAARHLTLACHYDSKFFPPGLPPFVGATDSAVPCALLLELVQALDAMLSRIKQQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQIMESIPHSPGPTRIQAIELFVLLDLLGASSPIFFSHFPRTARWFQRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPPGPVEDDHIPFLRRGVPVLHLIATPFPAVWHTPADTEANLHPPTVHNLSRILAVFLAEYLGL |
| Endotoxin : | <1EU/μg by LAL |
| Purity : | >90% by SDS-PAGE |
| Labeling efficiency : | 2.01 by HABA |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4 |
| Concentration : | 0.69 mg/mL by BCA |
| Conjugation : | Biotin |
| Gene Name | Qpctl glutaminyl-peptide cyclotransferase-like [ Mus musculus (house mouse) ] |
| Official Symbol | QPCTL |
| Synonyms | QPCTL; glutaminyl-peptide cyclotransferase-like; glutaminyl-peptide cyclotransferase-like protein; isoQC; golgi-resident glutaminyl-peptide cyclotransferase; gQC; BB101812; 1810019P04Rik |
| Gene ID | 67369 |
| mRNA Refseq | NM_026111 |
| Protein Refseq | NP_080387 |
| UniProt ID | Q8BH73 |
| ◆ Cell & Tissue Lysates | ||
| QPCTL-2133HCL | Recombinant Human QPCTL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (1)
- Q&As (0)
Customer Reviews
Write a reviewReviews
05/13/2025
I’m writing to inform you that the protein we received (QPCTL-7323M, Batch # PSQ3032547) is working properly on both SPR and biochemical assays. Many thanks for your effort and support on managing the preparation of this biological reagent.
Ask a Question for All QPCTL Products
Required fields are marked with *
My Review for All QPCTL Products
Required fields are marked with *
