Recombinant Human QSOX1
Cat.No. : | QSOX1-31036TH |
Product Overview : | Recombinant fragment of Human Quiescin Q6 with an N terminal proprietary tag. Predicted MW 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a protein that contains domains of thioredoxin and ERV1, members of two long-standing gene families. The gene expression is induced as fibroblasts begin to exit the proliferative cycle and enter quiescence, suggesting that this gene plays an important role in growth regulation. Two transcript variants encoding two different isoforms have been found for this gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Expressed in heart, placenta, lung, liver, skeletal muscle, pancreas and very weakly in brain and kidney. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KALAEDVKAWRPALYLAALDCAEETNSAVCRDFNIPGFPTVRFFKAFTKNGSGAVFPVAGADVQTLRERLIDALESHHDTWPPACPPLEPAKLEEIDGFF |
Sequence Similarities : | Belongs to the quiescin-sulfhydryl oxidase (QSOX) family.Contains 1 ERV/ALR sulfhydryl oxidase domain.Contains 1 thioredoxin domain. |
Gene Name | QSOX1 quiescin Q6 sulfhydryl oxidase 1 [ Homo sapiens ] |
Official Symbol | QSOX1 |
Synonyms | QSOX1; quiescin Q6 sulfhydryl oxidase 1; QSCN6, quiescin Q6; sulfhydryl oxidase 1; |
Gene ID | 5768 |
mRNA Refseq | NM_001004128 |
Protein Refseq | NP_001004128 |
MIM | 603120 |
Uniprot ID | O00391 |
Chromosome Location | 1q24 |
Function | flavin-linked sulfhydryl oxidase activity; flavin-linked sulfhydryl oxidase activity; oxidoreductase activity; |
◆ Recombinant Proteins | ||
RFL13911RF | Recombinant Full Length Rat Sulfhydryl Oxidase 1(Qsox1) Protein, His-Tagged | +Inquiry |
QSOX1-4527R | Recombinant Rat QSOX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
QSOX1-2095H | Recombinant Human QSOX1, GST-tagged | +Inquiry |
RFL28779HF | Recombinant Full Length Human Sulfhydryl Oxidase 1(Qsox1) Protein, His-Tagged | +Inquiry |
QSOX1-7328M | Recombinant Mouse QSOX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
QSOX1-2635HCL | Recombinant Human QSOX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All QSOX1 Products
Required fields are marked with *
My Review for All QSOX1 Products
Required fields are marked with *