Recombinant Human QSOX1

Cat.No. : QSOX1-31036TH
Product Overview : Recombinant fragment of Human Quiescin Q6 with an N terminal proprietary tag. Predicted MW 36.63kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a protein that contains domains of thioredoxin and ERV1, members of two long-standing gene families. The gene expression is induced as fibroblasts begin to exit the proliferative cycle and enter quiescence, suggesting that this gene plays an important role in growth regulation. Two transcript variants encoding two different isoforms have been found for this gene.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Expressed in heart, placenta, lung, liver, skeletal muscle, pancreas and very weakly in brain and kidney.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KALAEDVKAWRPALYLAALDCAEETNSAVCRDFNIPGFPTVRFFKAFTKNGSGAVFPVAGADVQTLRERLIDALESHHDTWPPACPPLEPAKLEEIDGFF
Sequence Similarities : Belongs to the quiescin-sulfhydryl oxidase (QSOX) family.Contains 1 ERV/ALR sulfhydryl oxidase domain.Contains 1 thioredoxin domain.
Gene Name QSOX1 quiescin Q6 sulfhydryl oxidase 1 [ Homo sapiens ]
Official Symbol QSOX1
Synonyms QSOX1; quiescin Q6 sulfhydryl oxidase 1; QSCN6, quiescin Q6; sulfhydryl oxidase 1;
Gene ID 5768
mRNA Refseq NM_001004128
Protein Refseq NP_001004128
MIM 603120
Uniprot ID O00391
Chromosome Location 1q24
Function flavin-linked sulfhydryl oxidase activity; flavin-linked sulfhydryl oxidase activity; oxidoreductase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All QSOX1 Products

Required fields are marked with *

My Review for All QSOX1 Products

Required fields are marked with *

0
cart-icon