Recombinant Human RAB14 protein, GST-tagged
| Cat.No. : | RAB14-1786H |
| Product Overview : | Recombinant Human RAB14 protein(1-215 aa), fused to GST tag, was expressed in E. coli. |
| Availability | November 29, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-215 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | RAB14 RAB14, member RAS oncogene family [ Homo sapiens ] |
| Official Symbol | RAB14 |
| Synonyms | RAB14; RAB14, member RAS oncogene family; ras-related protein Rab-14; bA165P4.3 (member RAS oncogene family); F protein binding protein 1; FBP; RAB 14; small GTP binding protein RAB14; F protein-binding protein 1; RAB-14; |
| Gene ID | 51552 |
| mRNA Refseq | NM_016322 |
| Protein Refseq | NP_057406 |
| MIM | 612673 |
| UniProt ID | P61106 |
| ◆ Recombinant Proteins | ||
| RAB14-11540Z | Recombinant Zebrafish RAB14 | +Inquiry |
| RAB14-2975H | Recombinant Human RAB14, T7-tagged | +Inquiry |
| RAB14-2101H | Recombinant Human RAB14, His-tagged | +Inquiry |
| RAB14-2024C | Recombinant Chicken RAB14 | +Inquiry |
| RAB14-1786H | Recombinant Human RAB14 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RAB14-2627HCL | Recombinant Human RAB14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB14 Products
Required fields are marked with *
My Review for All RAB14 Products
Required fields are marked with *
