Recombinant Human RAB14 protein, T7-tagged
| Cat.No. : | RAB14-216H |
| Product Overview : | Recombinant human RAB14 (215aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | T7 |
| Protein Length : | 215 a.a. |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGEFMATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKI KLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVT YEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQR EGCGC |
| Purity : | >90% by SDS-PAGE. |
| Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days. |
| Gene Name | RAB14 RAB14, member RAS oncogene family [ Homo sapiens ] |
| Official Symbol | RAB14 |
| Synonyms | RAB14; RAB14, member RAS oncogene family; ras-related protein Rab-14; bA165P4.3 (member RAS oncogene family); F protein binding protein 1; FBP; RAB 14;RAB-14; |
| Gene ID | 51552 |
| mRNA Refseq | NM_016322 |
| Protein Refseq | NP_057406 |
| MIM | 612673 |
| UniProt ID | P61106 |
| Chromosome Location | 9q32-q34.11 |
| Function | GDP binding; GTP binding; GTPase activity; GTPase activity; glycoprotein binding; nucleotide binding; protein binding; |
| ◆ Recombinant Proteins | ||
| RAB14-4876R | Recombinant Rat RAB14 Protein | +Inquiry |
| RAB14-2101H | Recombinant Human RAB14, His-tagged | +Inquiry |
| RAB14-1786H | Recombinant Human RAB14 protein, GST-tagged | +Inquiry |
| Rab14-5291M | Recombinant Mouse Rab14 Protein, Myc/DDK-tagged | +Inquiry |
| RAB14-3587H | Recombinant Human RAB14, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RAB14-2627HCL | Recombinant Human RAB14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB14 Products
Required fields are marked with *
My Review for All RAB14 Products
Required fields are marked with *
