"RAB14" Related Products

Expand

Recombinant Human RAB14 protein, T7-tagged

Cat.No. : RAB14-216H
Product Overview : Recombinant human RAB14 (215aa) fused with T7 Tag at N-terminal was expressed in E. coli.
Source : E. coli
Species : Human
Tag : T7
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFMATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKI KLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVT YEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQR EGCGC
Purity : >90% by SDS-PAGE.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name : RAB14 RAB14, member RAS oncogene family [ Homo sapiens ]
Official Symbol : RAB14
Synonyms : RAB14; RAB14, member RAS oncogene family; ras-related protein Rab-14; bA165P4.3 (member RAS oncogene family); F protein binding protein 1; FBP; RAB 14;RAB-14;
Gene ID : 51552
mRNA Refseq : NM_016322
Protein Refseq : NP_057406
MIM : 612673
UniProt ID : P61106
Chromosome Location : 9q32-q34.11
Function : GDP binding; GTP binding; GTPase activity; GTPase activity; glycoprotein binding; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.