Recombinant Human RAB18 protein, His-tagged
| Cat.No. : | RAB18-3541H |
| Product Overview : | Recombinant Human RAB18 protein(1-206 aa), fused to His tag, was expressed in E. coli. |
| Availability | September 24, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-206 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYCSVL |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | RAB18 RAB18, member RAS oncogene family [ Homo sapiens ] |
| Official Symbol | RAB18 |
| Synonyms | RAB18; RAB18, member RAS oncogene family; ras-related protein Rab-18; RAB18 small GTPase; WARBM3; RAB18LI1; |
| Gene ID | 22931 |
| mRNA Refseq | NM_001256410 |
| Protein Refseq | NP_001243339 |
| MIM | 602207 |
| UniProt ID | Q9NP72 |
| ◆ Recombinant Proteins | ||
| RAB18-30651TH | Recombinant Human RAB18, T7 -tagged | +Inquiry |
| RAB18-1657H | Recombinant Human RAB18 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RAB18-2103H | Recombinant Human RAB18, GST-tagged | +Inquiry |
| RAB18-712M | Active Recombinant Mouse RAB18 Protein, GST/His-tagged | +Inquiry |
| RAB18-4537R | Recombinant Rat RAB18 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RAB18-2625HCL | Recombinant Human RAB18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB18 Products
Required fields are marked with *
My Review for All RAB18 Products
Required fields are marked with *
