Recombinant Human RAB18 protein, His-tagged
Cat.No. : | RAB18-3541H |
Product Overview : | Recombinant Human RAB18 protein(1-206 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-206 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYCSVL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RAB18 RAB18, member RAS oncogene family [ Homo sapiens ] |
Official Symbol | RAB18 |
Synonyms | RAB18; RAB18, member RAS oncogene family; ras-related protein Rab-18; RAB18 small GTPase; WARBM3; RAB18LI1; |
Gene ID | 22931 |
mRNA Refseq | NM_001256410 |
Protein Refseq | NP_001243339 |
MIM | 602207 |
UniProt ID | Q9NP72 |
◆ Recombinant Proteins | ||
RAB18-3541H | Recombinant Human RAB18 protein, His-tagged | +Inquiry |
RAB18-3551R | Recombinant Rhesus Macaque RAB18 Protein, His (Fc)-Avi-tagged | +Inquiry |
Rab18-5293M | Recombinant Mouse Rab18 Protein, Myc/DDK-tagged | +Inquiry |
RAB18-2103H | Recombinant Human RAB18, GST-tagged | +Inquiry |
Rab18-1099M | Active Recombinant Mouse RAB18, Member RAS Oncogene Family, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB18-2625HCL | Recombinant Human RAB18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAB18 Products
Required fields are marked with *
My Review for All RAB18 Products
Required fields are marked with *
0
Inquiry Basket