Recombinant Human RAB21 protein, T7/His-tagged
Cat.No. : | RAB21-204H |
Product Overview : | Recombinant human Rab21 cDNA (224 aa, derived from BC092475) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFAAAGGGGGGAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDK HITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLG NEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQ PGTARRGVQIIDDEPQAQTSGGGCCSSG |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | RAB21 RAB21, member RAS oncogene family [ Homo sapiens ] |
Official Symbol | RAB21 |
Synonyms | RAB21; RAB21, member RAS oncogene family; ras-related protein Rab-21; KIAA0118; |
Gene ID | 23011 |
mRNA Refseq | NM_014999 |
Protein Refseq | NP_055814 |
MIM | 612398 |
UniProt ID | Q9UL25 |
Chromosome Location | 12q15 |
Function | GDP binding; GTP binding; GTPase activity; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
Rab21-5297M | Recombinant Mouse Rab21 Protein, Myc/DDK-tagged | +Inquiry |
RAB21-7345M | Recombinant Mouse RAB21 Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB21-3473H | Recombinant Human RAB21, His-tagged | +Inquiry |
RAB21-3903H | Recombinant Human RAB21 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RAB21-13796M | Recombinant Mouse RAB21 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB21-2620HCL | Recombinant Human RAB21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB21 Products
Required fields are marked with *
My Review for All RAB21 Products
Required fields are marked with *