Recombinant Human RAB21 protein, T7/His-tagged
| Cat.No. : | RAB21-204H |
| Product Overview : | Recombinant human Rab21 cDNA (224 aa, derived from BC092475) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Form : | 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT |
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFAAAGGGGGGAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDK HITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLG NEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQ PGTARRGVQIIDDEPQAQTSGGGCCSSG |
| Purity : | >90% by SDS-PAGE |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | RAB21 RAB21, member RAS oncogene family [ Homo sapiens ] |
| Official Symbol | RAB21 |
| Synonyms | RAB21; RAB21, member RAS oncogene family; ras-related protein Rab-21; KIAA0118; |
| Gene ID | 23011 |
| mRNA Refseq | NM_014999 |
| Protein Refseq | NP_055814 |
| MIM | 612398 |
| UniProt ID | Q9UL25 |
| Chromosome Location | 12q15 |
| Function | GDP binding; GTP binding; GTPase activity; nucleotide binding; protein binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB21 Products
Required fields are marked with *
My Review for All RAB21 Products
Required fields are marked with *




