Recombinant Human RAB23 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RAB23-3038H
Product Overview : RAB23 MS Standard C13 and N15-labeled recombinant protein (NP_057361) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a small GTPase of the Ras superfamily. Rab proteins are involved in the regulation of diverse cellular functions associated with intracellular membrane trafficking, including autophagy and immune response to bacterial infection. The encoded protein may play a role in central nervous system development by antagonizing sonic hedgehog signaling. Disruption of this gene has been implicated in Carpenter syndrome as well as cancer. Alternative splicing results in multiple transcript variants.
Molecular Mass : 26.7 kDa
AA Sequence : MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTKKNRNPFSSCSIPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RAB23 RAB23, member RAS oncogene family [ Homo sapiens (human) ]
Official Symbol RAB23
Synonyms RAB23; RAB23, member RAS oncogene family; ras-related protein Rab-23; RAB family small GTP binding protein RAB 23; HSPC137; MGC8900; DKFZp781H0695;
Gene ID 51715
mRNA Refseq NM_016277
Protein Refseq NP_057361
MIM 606144
UniProt ID Q9ULC3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAB23 Products

Required fields are marked with *

My Review for All RAB23 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon