Recombinant Human RAB23 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RAB23-3038H |
Product Overview : | RAB23 MS Standard C13 and N15-labeled recombinant protein (NP_057361) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a small GTPase of the Ras superfamily. Rab proteins are involved in the regulation of diverse cellular functions associated with intracellular membrane trafficking, including autophagy and immune response to bacterial infection. The encoded protein may play a role in central nervous system development by antagonizing sonic hedgehog signaling. Disruption of this gene has been implicated in Carpenter syndrome as well as cancer. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 26.7 kDa |
AA Sequence : | MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTKKNRNPFSSCSIPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RAB23 RAB23, member RAS oncogene family [ Homo sapiens (human) ] |
Official Symbol | RAB23 |
Synonyms | RAB23; RAB23, member RAS oncogene family; ras-related protein Rab-23; RAB family small GTP binding protein RAB 23; HSPC137; MGC8900; DKFZp781H0695; |
Gene ID | 51715 |
mRNA Refseq | NM_016277 |
Protein Refseq | NP_057361 |
MIM | 606144 |
UniProt ID | Q9ULC3 |
◆ Recombinant Proteins | ||
RAB23-4447H | Recombinant Human RAB23 protein | +Inquiry |
Rab23-1102M | Active Recombinant Mouse RAB23, Member RAS Oncogene Family | +Inquiry |
RAB23-30800TH | Recombinant Human RAB23, His-tagged | +Inquiry |
RAB23-1290H | Recombinant Human RAB23, Member RAS Oncogene Family, His-tagged | +Inquiry |
RAB23-3739R | Recombinant Rhesus monkey RAB23 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB23-2618HCL | Recombinant Human RAB23 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAB23 Products
Required fields are marked with *
My Review for All RAB23 Products
Required fields are marked with *
0
Inquiry Basket