Recombinant Human RAB27A protein, GST-tagged

Cat.No. : RAB27A-334H
Product Overview : Recombinant Human RAB27A protein(NP_004571)(1-221 aa), GST-tagged
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-221 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
Gene Name RAB27A RAB27A, member RAS oncogene family [ Homo sapiens ]
Official Symbol RAB27A
Synonyms RAB27A; RAB27A, member RAS oncogene family; ras-related protein Rab-27A; GS2; HsT18676; RAB27; RAM; rab-27; GTP-binding protein Ram; MGC117246;
Gene ID 5873
mRNA Refseq NM_004580
Protein Refseq NP_004571
MIM 603868
UniProt ID P51159

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAB27A Products

Required fields are marked with *

My Review for All RAB27A Products

Required fields are marked with *

0
cart-icon
0
compare icon