Recombinant Human RAB27A protein, GST-tagged
Cat.No. : | RAB27A-334H |
Product Overview : | Recombinant Human RAB27A protein(NP_004571)(1-221 aa), GST-tagged |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-221 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). |
Gene Name | RAB27A RAB27A, member RAS oncogene family [ Homo sapiens ] |
Official Symbol | RAB27A |
Synonyms | RAB27A; RAB27A, member RAS oncogene family; ras-related protein Rab-27A; GS2; HsT18676; RAB27; RAM; rab-27; GTP-binding protein Ram; MGC117246; |
Gene ID | 5873 |
mRNA Refseq | NM_004580 |
Protein Refseq | NP_004571 |
MIM | 603868 |
UniProt ID | P51159 |
◆ Recombinant Proteins | ||
RAB27A-3338Z | Recombinant Zebrafish RAB27A | +Inquiry |
RAB27A-2479H | Recombinant Human RAB27A, His-tagged | +Inquiry |
Rab27a-1106R | Active Recombinant Rat RAB27A, Member RAS Oncogene Family | +Inquiry |
Rab27a-658M | Recombinant Mouse Rab27a Protein, MYC/DDK-tagged | +Inquiry |
RAB27A-3557R | Recombinant Rhesus Macaque RAB27A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB27A-2613HCL | Recombinant Human RAB27A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAB27A Products
Required fields are marked with *
My Review for All RAB27A Products
Required fields are marked with *
0
Inquiry Basket