Recombinant Human RAB27A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RAB27A-592H
Product Overview : RAB27A MS Standard C13 and N15-labeled recombinant protein (NP_899058) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations in this gene are associated with Griscelli syndrome type 2. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified.
Molecular Mass : 24.9 kDa
AA Sequence : MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RAB27A RAB27A, member RAS oncogene family [ Homo sapiens (human) ]
Official Symbol RAB27A
Synonyms RAB27A; RAB27A, member RAS oncogene family; ras-related protein Rab-27A; GS2; HsT18676; RAB27; RAM; rab-27; GTP-binding protein Ram; MGC117246;
Gene ID 5873
mRNA Refseq NM_183235
Protein Refseq NP_899058
MIM 603868
UniProt ID P51159

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAB27A Products

Required fields are marked with *

My Review for All RAB27A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon