Recombinant Human RAB27B protein, His-SUMO-tagged
Cat.No. : | RAB27B-3401H |
Product Overview : | Recombinant Human RAB27B protein(O00194)(2-218aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-218aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 40.5 kDa |
AA Sequence : | TDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | RAB27B RAB27B, member RAS oncogene family [ Homo sapiens ] |
Official Symbol | RAB27B |
Synonyms | RAB27B; RAB27B, member RAS oncogene family; ras-related protein Rab-27B; C25KG; |
Gene ID | 5874 |
mRNA Refseq | NM_004163 |
Protein Refseq | NP_004154 |
MIM | 603869 |
UniProt ID | O00194 |
◆ Recombinant Proteins | ||
RAB27B-376H | Recombinant Human RAB27B | +Inquiry |
RAB27B-2648H | Recombinant Human RAB27B Protein, His-tagged | +Inquiry |
RAB27B-4883R | Recombinant Rat RAB27B Protein | +Inquiry |
RAB27B-377H | Recombinant Human RAB27B, Fc-tagged | +Inquiry |
RAB27B-4542R | Recombinant Rat RAB27B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB27B-001HCL | Recombinant Human RAB27B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAB27B Products
Required fields are marked with *
My Review for All RAB27B Products
Required fields are marked with *
0
Inquiry Basket