Recombinant Human RAB2B, His-tagged
Cat.No. : | RAB2B-30602TH |
Product Overview : | Recombinant full length Human RAB2B with N terminal His tag; 240 amino acids with tag, Predicted MWt 26.8 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 216 amino acids |
Description : | Members of the Rab protein family are nontransforming monomeric GTP-binding proteins of the Ras superfamily that contain 4 highly conserved regions involved in GTP binding and hydrolysis. Rab proteins are prenylated, membrane-bound proteins involved in vesicular fusion and trafficking; see MIM 179508. |
Conjugation : | HIS |
Molecular Weight : | 26.800kDa inclusive of tags |
Tissue specificity : | Expressed in kidney, prostate, lung, liver, thymus, colon, pancreas, and skeletal muscle, and low levels in placenta. Not detected in heart, brain, spleen, testis, ovary, small intestine and leukocyte. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.88% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMTYAYLFKYIIIGDTG VGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIK LQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNH LTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVKREEGEA FAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGLF DVHNEANGIKIGPQQSISTSVGPSASQRNSRDIGSNSGCC |
Sequence Similarities : | Belongs to the small GTPase superfamily. Rab family. |
Gene Name | RAB2B RAB2B, member RAS oncogene family [ Homo sapiens ] |
Official Symbol | RAB2B |
Synonyms | RAB2B; RAB2B, member RAS oncogene family; ras-related protein Rab-2B; FLJ14824; |
Gene ID | 84932 |
mRNA Refseq | NM_001163380 |
Protein Refseq | NP_001156852 |
MIM | 607466 |
Uniprot ID | Q8WUD1 |
Chromosome Location | 14q11.1 |
Function | GTP binding; nucleotide binding; |
◆ Recombinant Proteins | ||
Rab2b-5306M | Recombinant Mouse Rab2b Protein, Myc/DDK-tagged | +Inquiry |
RAB2B-4828H | Recombinant Human RAB2B, Member RAS Oncogene Family, His-tagged | +Inquiry |
RAB2B-7349M | Recombinant Mouse RAB2B Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB2B-30602TH | Recombinant Human RAB2B, His-tagged | +Inquiry |
RAB2B-13806M | Recombinant Mouse RAB2B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB2B-2610HCL | Recombinant Human RAB2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAB2B Products
Required fields are marked with *
My Review for All RAB2B Products
Required fields are marked with *
0
Inquiry Basket