| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
216 amino acids |
| Description : |
Members of the Rab protein family are nontransforming monomeric GTP-binding proteins of the Ras superfamily that contain 4 highly conserved regions involved in GTP binding and hydrolysis. Rab proteins are prenylated, membrane-bound proteins involved in vesicular fusion and trafficking; see MIM 179508. |
| Conjugation : |
HIS |
| Molecular Weight : |
26.800kDa inclusive of tags |
| Tissue specificity : |
Expressed in kidney, prostate, lung, liver, thymus, colon, pancreas, and skeletal muscle, and low levels in placenta. Not detected in heart, brain, spleen, testis, ovary, small intestine and leukocyte. |
| Form : |
Liquid |
| Purity : |
>95% by SDS-PAGE |
| Storage buffer : |
pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.88% Sodium chloride |
| Storage : |
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : |
MGSSHHHHHHSSGLVPRGSHMGSHMTYAYLFKYIIIGDTG VGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIK LQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNH LTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVKREEGEA FAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGLF DVHNEANGIKIGPQQSISTSVGPSASQRNSRDIGSNSGCC |
| Sequence Similarities : |
Belongs to the small GTPase superfamily. Rab family. |