Recombinant Human RAB2B, His-tagged

Cat.No. : RAB2B-30602TH
Product Overview : Recombinant full length Human RAB2B with N terminal His tag; 240 amino acids with tag, Predicted MWt 26.8 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 216 amino acids
Description : Members of the Rab protein family are nontransforming monomeric GTP-binding proteins of the Ras superfamily that contain 4 highly conserved regions involved in GTP binding and hydrolysis. Rab proteins are prenylated, membrane-bound proteins involved in vesicular fusion and trafficking; see MIM 179508.
Conjugation : HIS
Molecular Weight : 26.800kDa inclusive of tags
Tissue specificity : Expressed in kidney, prostate, lung, liver, thymus, colon, pancreas, and skeletal muscle, and low levels in placenta. Not detected in heart, brain, spleen, testis, ovary, small intestine and leukocyte.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.88% Sodium chloride
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSHMTYAYLFKYIIIGDTG VGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIK LQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNH LTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVKREEGEA FAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGLF DVHNEANGIKIGPQQSISTSVGPSASQRNSRDIGSNSGCC
Sequence Similarities : Belongs to the small GTPase superfamily. Rab family.
Gene Name RAB2B RAB2B, member RAS oncogene family [ Homo sapiens ]
Official Symbol RAB2B
Synonyms RAB2B; RAB2B, member RAS oncogene family; ras-related protein Rab-2B; FLJ14824;
Gene ID 84932
mRNA Refseq NM_001163380
Protein Refseq NP_001156852
MIM 607466
Uniprot ID Q8WUD1
Chromosome Location 14q11.1
Function GTP binding; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAB2B Products

Required fields are marked with *

My Review for All RAB2B Products

Required fields are marked with *

0
cart-icon