Recombinant Human RAB2B, His-tagged

• Cat.No.: RAB2B-30602TH
• Product Overview: Recombinant full length Human RAB2B with N terminal His tag; 240 amino acids with tag, Predicted MWt 26.8 kDa.

Specification

• Description: Members of the Rab protein family are nontransforming monomeric GTP-binding proteins of the Ras superfamily that contain 4 highly conserved regions involved in GTP binding and hydrolysis. Rab proteins are prenylated, membrane-bound proteins involved in vesicular fusion and trafficking; see MIM 179508.
• Protein length: 216 amino acids
• Conjugation: HIS
• Molecular Weight: 26.800kDa inclusive of tags
• Source: E. coli
• Tissue specificity: Expressed in kidney, prostate, lung, liver, thymus, colon, pancreas, and skeletal muscle, and low levels in placenta. Not detected in heart, brain, spleen, testis, ovary, small intestine and leukocyte.
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.88% Sodium chloride
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSHMTYAYLFKYIIIGDTG VGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIK LQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNH LTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVKREEGEA FAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGLF DVHNEANGIKIGPQQSISTSVGPSASQRNSRDIGSNSGCC
• Sequence Similarities: Belongs to the small GTPase superfamily. Rab family.

Gene Information

• Gene Name: RAB2B RAB2B, member RAS oncogene family [ Homo sapiens ]
• Official Symbol: RAB2B
• Synonyms: RAB2B; RAB2B, member RAS oncogene family; ras-related protein Rab-2B; FLJ14824
• Gene ID: 84932
• mRNA Refseq: NM_001163380
• Protein Refseq: NP_001156852
• MIM: 607466
• Uniprot ID: Q8WUD1
• Chromosome Location: 14q11.1
• Function: GTP binding; nucleotide binding