Recombinant Human RAB31 protein, GST-tagged
| Cat.No. : | RAB31-4381H |
| Product Overview : | Recombinant Human RAB31 protein(Q13636)(1-194aa), fused to N-terminal GST tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-194aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 48.6 kDa |
| AA Sequence : | MAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | RAB31 RAB31, member RAS oncogene family [ Homo sapiens ] |
| Official Symbol | RAB31 |
| Synonyms | RAB31; RAB31, member RAS oncogene family; ras-related protein Rab-31; Rab22B; ras-related protein Rab-22B; |
| Gene ID | 11031 |
| mRNA Refseq | NM_006868 |
| Protein Refseq | NP_006859 |
| MIM | 605694 |
| UniProt ID | Q13636 |
| ◆ Recombinant Proteins | ||
| RAB31-3744R | Recombinant Rhesus monkey RAB31 Protein, His-tagged | +Inquiry |
| RAB31-3561R | Recombinant Rhesus Macaque RAB31 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RAB31-378H | Recombinant Human RAB31 protein(Met1-Cys195), His-tagged | +Inquiry |
| RAB31-1108H | Active Recombinant Human RAB31, Member RAS Oncogene Family, GST-tagged | +Inquiry |
| RAB31-28751TH | Recombinant Human RAB31, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RAB31-2608HCL | Recombinant Human RAB31 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB31 Products
Required fields are marked with *
My Review for All RAB31 Products
Required fields are marked with *
