Recombinant Human RAB33A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RAB33A-3514H
• Product Overview: RAB33A MS Standard C13 and N15-labeled recombinant protein (NP_004785) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. It is GTP-binding protein and may be involved in vesicle transport.
• Molecular Mass: 26.6 kDa
• AA Sequence: MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSCPCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RAB33A RAB33A, member RAS oncogene family [ Homo sapiens (human) ]
• Official Symbol: RAB33A
• Synonyms: RAB33A; RAB33A, member RAS oncogene family; ras-related protein Rab-33A; RabS10; Small GTP-binding protein S10; MGC1488
• Gene ID: 9363
• mRNA Refseq: NM_004794
• Protein Refseq: NP_004785
• MIM: 300333
• UniProt ID: Q14088