Recombinant Human RAB39A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RAB39A-573H
• Product Overview: RAB39 MS Standard C13 and N15-labeled recombinant protein (NP_059986) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Plays a role in the maturation and acidification of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis. Plays a role in vesicular trafficking. Plays a role in the fusion of phagosomes with lysosomes. Negatively regulates LPS-induced autophagosome formation in macrophages possibly by implicating PI3K. May be involved in multiple neurite formation.
• Molecular Mass: 25 kDa
• AA Sequence: METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFFSRLLEIEPGKRIKLQLWDTAGQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMYVQPFRIVFLLVGHKCDLASQRQVTREEAEKLSADCGMKYIETSAKDATNVEESFTILTRDIYELIKKGEICIQDGWEGVKSGFVPNTVHSSEEAVKPRKECFCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RAB39A RAB39A, member RAS oncogene family [ Homo sapiens (human) ]
• Official Symbol: RAB39A
• Synonyms: RAB39A; RAB39A, member RAS oncogene family; RAB39; ras-related protein Rab-39A; RAB39, member RAS oncogene family; rab-39; rab-related GTP-binding protein
• Gene ID: 54734
• mRNA Refseq: NM_017516
• Protein Refseq: NP_059986
• UniProt ID: Q14964