Recombinant Human RAB3A Protein, MYC/DDK-tagged, C13 and N15-labeled
| Cat.No. : | RAB3A-011H |
| Product Overview : | RAB3A MS Standard C13 and N15-labeled recombinant protein (NP_002857) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Involved in exocytosis by regulating a late step in synaptic vesicle fusion. Could play a role in neurotransmitter release by regulating membrane flow in the nerve terminal. |
| Molecular Mass : | 25 kDa |
| AA Sequence : | MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCACTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | RAB3A RAB3A, member RAS oncogene family [ Homo sapiens (human) ] |
| Official Symbol | RAB3A |
| Synonyms | RAB3A; RAB3A, member RAS oncogene family; ras-related protein Rab-3A; RAS-associated protein RAB3A |
| Gene ID | 5864 |
| mRNA Refseq | NM_002866 |
| Protein Refseq | NP_002857 |
| MIM | 179490 |
| UniProt ID | P20336 |
| ◆ Recombinant Proteins | ||
| RAB3A-3751R | Recombinant Rhesus monkey RAB3A Protein, His-tagged | +Inquiry |
| RAB3A-580C | Recombinant Cynomolgus Monkey RAB3A Protein, His (Fc)-Avi-tagged | +Inquiry |
| RAB3A-3586H | Recombinant Full Length Human RAB3A Protein, His-tagged | +Inquiry |
| Rab3a-1112R | Active Recombinant Rat RAB3A, Member RAS Oncogene Family, GST-tagged | +Inquiry |
| RAB3A-1835H | Recombinant Human RAB3A Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB3A Products
Required fields are marked with *
My Review for All RAB3A Products
Required fields are marked with *
