Recombinant Human RAB3A Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : RAB3A-011H
Product Overview : RAB3A MS Standard C13 and N15-labeled recombinant protein (NP_002857) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Involved in exocytosis by regulating a late step in synaptic vesicle fusion. Could play a role in neurotransmitter release by regulating membrane flow in the nerve terminal.
Molecular Mass : 25 kDa
AA Sequence : MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCACTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RAB3A RAB3A, member RAS oncogene family [ Homo sapiens (human) ]
Official Symbol RAB3A
Synonyms RAB3A; RAB3A, member RAS oncogene family; ras-related protein Rab-3A; RAS-associated protein RAB3A
Gene ID 5864
mRNA Refseq NM_002866
Protein Refseq NP_002857
MIM 179490
UniProt ID P20336

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAB3A Products

Required fields are marked with *

My Review for All RAB3A Products

Required fields are marked with *

0
cart-icon
0
compare icon