Recombinant Human RAB3A Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: RAB3A-011H
• Product Overview: RAB3A MS Standard C13 and N15-labeled recombinant protein (NP_002857) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Involved in exocytosis by regulating a late step in synaptic vesicle fusion. Could play a role in neurotransmitter release by regulating membrane flow in the nerve terminal.
• Molecular Mass: 25 kDa
• AA Sequence: MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCACTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RAB3A RAB3A, member RAS oncogene family [ Homo sapiens (human) ]
• Official Symbol: RAB3A
• Synonyms: RAB3A; RAB3A, member RAS oncogene family; ras-related protein Rab-3A; RAS-associated protein RAB3A
• Gene ID: 5864
• mRNA Refseq: NM_002866
• Protein Refseq: NP_002857
• MIM: 179490
• UniProt ID: P20336