Recombinant Human RAB3D, His-tagged
Cat.No. : | RAB3D-31275TH |
Product Overview : | Recombinant full length Human Rab3D with an N terminal His tag; 239 amino acids with tag, Predicted MWt 26.4 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 219 amino acids |
Description : | Ras-related protein Rab-3D, also known as GOV, is a member of the Ras superfamily of small Rab GTPases. Rab proteins play an important role for, either in endocytosis or in biosynthetic protein transport. |
Conjugation : | HIS |
Molecular Weight : | 26.400kDa inclusive of tags |
Tissue specificity : | Highly expressed in granulocytes of peripheral blood. Constitutively expressed at low levels in all hematopoietic cell lines investigated. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMASAGDTQAGPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC |
Sequence Similarities : | Belongs to the small GTPase superfamily. Rab family. |
Gene Name | RAB3D RAB3D, member RAS oncogene family [ Homo sapiens ] |
Official Symbol | RAB3D |
Synonyms | RAB3D; RAB3D, member RAS oncogene family; GOV; ras-related protein Rab-3D; D2 2; glioblastoma overexpressed; Rab3D upregulated with myeloid differentiation; RAB16; RAD3D; |
Gene ID | 9545 |
mRNA Refseq | NM_004283 |
Protein Refseq | NP_004274 |
MIM | 604350 |
Uniprot ID | O95716 |
Chromosome Location | 19p13.2 |
Pathway | Pancreatic secretion, organism-specific biosystem; Pancreatic secretion, conserved biosystem; |
Function | GTP binding; GTPase activity; GTPase binding; nucleotide binding; |
◆ Recombinant Proteins | ||
RAB3D-7355M | Recombinant Mouse RAB3D Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB3D-3754R | Recombinant Rhesus monkey RAB3D Protein, His-tagged | +Inquiry |
RAB3D-31275TH | Recombinant Human RAB3D, His-tagged | +Inquiry |
RAB3D-3585H | Recombinant Human RAB3D, His-tagged | +Inquiry |
RAB3D-4892R | Recombinant Rat RAB3D Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB3D Products
Required fields are marked with *
My Review for All RAB3D Products
Required fields are marked with *