Recombinant Human RAB3IP protein, His-tagged

Cat.No. : RAB3IP-2629H
Product Overview : Recombinant Human RAB3IP protein(21-254 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : His
Protein Length : 21-254 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : GKIDVLQAEVAALKTLVLSSSPTSPTQEPLPGGKTPFKKGHTRNKSTSSAMSGSHQDLSVIQPIVKDCKEADLSLYNEFRLWKDEPTMDRTCPFLDKIYQEDIFPCLTFSKSELASAVLEAVENNTLSIEPVGLQPIRFVKASAVECGGPKKCALTGQSKSCKHRIKLGDSSNYYYISPFCRYRITSVCNFFTYIRYIQQGLVKQQDVDQMFWEVMQLRKEMSLAKLGYFKEEL
Purity : 85%, by SDS-PAGE.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAB3IP Products

Required fields are marked with *

My Review for All RAB3IP Products

Required fields are marked with *

0
cart-icon