Recombinant Human RAB4A protein, His-tagged
Cat.No. : | RAB4A-3929H |
Product Overview : | Recombinant Human RAB4A protein(166-218 aa), fused to His tag, was expressed in E. coli. |
Availability | August 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 166-218 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | AFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RAB4A RAB4A, member RAS oncogene family [ Homo sapiens ] |
Official Symbol | RAB4A |
Synonyms | RAB4A; RAB4A, member RAS oncogene family; RAB4; ras-related protein Rab-4A; HRES 1/RAB4; Oncogene RAB4; RAB4, member RAS oncogene family; HRES-1/RAB4; |
Gene ID | 5867 |
mRNA Refseq | NM_004578 |
Protein Refseq | NP_004569 |
MIM | 179511 |
UniProt ID | P20338 |
◆ Recombinant Proteins | ||
RAB4A-710H | Active Recombinant Human RAB4A Protein, GST/His-tagged | +Inquiry |
RAB4A-4896R | Recombinant Rat RAB4A Protein | +Inquiry |
RAB4A-2129H | Recombinant Human RAB4A, GST-tagged | +Inquiry |
RAB4A-3755R | Recombinant Rhesus monkey RAB4A Protein, His-tagged | +Inquiry |
RAB4A-4555R | Recombinant Rat RAB4A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB4A-2589HCL | Recombinant Human RAB4A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB4A Products
Required fields are marked with *
My Review for All RAB4A Products
Required fields are marked with *