Recombinant Human RAB4A protein, His-tagged
| Cat.No. : | RAB4A-3929H |
| Product Overview : | Recombinant Human RAB4A protein(166-218 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 29, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 166-218 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | AFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | RAB4A RAB4A, member RAS oncogene family [ Homo sapiens ] |
| Official Symbol | RAB4A |
| Synonyms | RAB4A; RAB4A, member RAS oncogene family; RAB4; ras-related protein Rab-4A; HRES 1/RAB4; Oncogene RAB4; RAB4, member RAS oncogene family; HRES-1/RAB4; |
| Gene ID | 5867 |
| mRNA Refseq | NM_004578 |
| Protein Refseq | NP_004569 |
| MIM | 179511 |
| UniProt ID | P20338 |
| ◆ Recombinant Proteins | ||
| RAB4A-2977H | Recombinant Human RAB4A, T7-tagged | +Inquiry |
| RAB4A-6708Z | Recombinant Zebrafish RAB4A | +Inquiry |
| RAB4A-31276TH | Recombinant Human RAB4A | +Inquiry |
| RAB4A-4896R | Recombinant Rat RAB4A Protein | +Inquiry |
| RAB4A-2129H | Recombinant Human RAB4A, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RAB4A-2589HCL | Recombinant Human RAB4A 293 Cell Lysate | +Inquiry |
| RAB4A-413HKCL | Human RAB4A Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB4A Products
Required fields are marked with *
My Review for All RAB4A Products
Required fields are marked with *
