Recombinant Human RAB5A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RAB5A-6255H
• Product Overview: RAB5A MS Standard C13 and N15-labeled recombinant protein (NP_004153) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: RAB5A (RAB5A, Member RAS Oncogene Family) is a Protein Coding gene. Diseases associated with RAB5A include Motor Neuron Disease and Choroideremia. Among its related pathways are RAB GEFs exchange GTP for GDP on RABs and TBC/RABGAPs. Gene Ontology (GO) annotations related to this gene include GTP binding and GDP binding. An important paralog of this gene is RAB5C.
• Molecular Mass: 23.7 kDa
• AA Sequence: MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RAB5A RAB5A, member RAS oncogene family [ Homo sapiens (human) ]
• Official Symbol: RAB5A
• Synonyms: RAB5A; RAB5A, member RAS oncogene family; RAB5; ras-related protein Rab-5A; RAS associated protein RAB5A; RAS-associated protein RAB5A
• Gene ID: 5868
• mRNA Refseq: NM_004162
• Protein Refseq: NP_004153
• MIM: 179512
• UniProt ID: P20339