Recombinant Human RAB5A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RAB5A-6255H |
Product Overview : | RAB5A MS Standard C13 and N15-labeled recombinant protein (NP_004153) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | RAB5A (RAB5A, Member RAS Oncogene Family) is a Protein Coding gene. Diseases associated with RAB5A include Motor Neuron Disease and Choroideremia. Among its related pathways are RAB GEFs exchange GTP for GDP on RABs and TBC/RABGAPs. Gene Ontology (GO) annotations related to this gene include GTP binding and GDP binding. An important paralog of this gene is RAB5C. |
Molecular Mass : | 23.7 kDa |
AA Sequence : | MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RAB5A RAB5A, member RAS oncogene family [ Homo sapiens (human) ] |
Official Symbol | RAB5A |
Synonyms | RAB5A; RAB5A, member RAS oncogene family; RAB5; ras-related protein Rab-5A; RAS associated protein RAB5A; RAS-associated protein RAB5A; |
Gene ID | 5868 |
mRNA Refseq | NM_004162 |
Protein Refseq | NP_004153 |
MIM | 179512 |
UniProt ID | P20339 |
◆ Recombinant Proteins | ||
RAB5A-859HFL | Recombinant Full Length Human RAB5A Protein, C-Flag-tagged | +Inquiry |
RAB5A-838C | Recombinant Cynomolgus RAB5A Protein, His-tagged | +Inquiry |
RAB5A-1507C | Recombinant Chicken RAB5A | +Inquiry |
RAB5A-13834M | Recombinant Mouse RAB5A Protein | +Inquiry |
RAB5A-301493H | Recombinant Human RAB5A protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB5A-2588HCL | Recombinant Human RAB5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB5A Products
Required fields are marked with *
My Review for All RAB5A Products
Required fields are marked with *