Recombinant Human RAB5A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RAB5A-6255H
Product Overview : RAB5A MS Standard C13 and N15-labeled recombinant protein (NP_004153) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : RAB5A (RAB5A, Member RAS Oncogene Family) is a Protein Coding gene. Diseases associated with RAB5A include Motor Neuron Disease and Choroideremia. Among its related pathways are RAB GEFs exchange GTP for GDP on RABs and TBC/RABGAPs. Gene Ontology (GO) annotations related to this gene include GTP binding and GDP binding. An important paralog of this gene is RAB5C.
Molecular Mass : 23.7 kDa
AA Sequence : MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RAB5A RAB5A, member RAS oncogene family [ Homo sapiens (human) ]
Official Symbol RAB5A
Synonyms RAB5A; RAB5A, member RAS oncogene family; RAB5; ras-related protein Rab-5A; RAS associated protein RAB5A; RAS-associated protein RAB5A;
Gene ID 5868
mRNA Refseq NM_004162
Protein Refseq NP_004153
MIM 179512
UniProt ID P20339

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAB5A Products

Required fields are marked with *

My Review for All RAB5A Products

Required fields are marked with *

0
cart-icon
0
compare icon