Recombinant Human RAB5C protein, GST-tagged

• Cat.No.: RAB5C-1231H
• Product Overview: Recombinant Human RAB5C protein(1-216 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-216 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: RAB5C RAB5C, member RAS oncogene family [ Homo sapiens ]
• Official Symbol: RAB5C
• Synonyms: RAB5C; RAB5C, member RAS oncogene family; RABL; ras-related protein Rab-5C; RAB; member of RAS oncogene family like; member of RAS oncogene family; RAB5CL; RAB5C, member of RAS oncogene family; L1880; RAB5L; MGC117217; MGC138857
• Gene ID: 5878
• mRNA Refseq: NM_001252039
• Protein Refseq: NP_001238968
• MIM: 604037
• UniProt ID: P51148