Recombinant Human RAB5C protein, GST-tagged
Cat.No. : | RAB5C-1231H |
Product Overview : | Recombinant Human RAB5C protein(1-216 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-216 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RAB5C RAB5C, member RAS oncogene family [ Homo sapiens ] |
Official Symbol | RAB5C |
Synonyms | RAB5C; RAB5C, member RAS oncogene family; RABL; ras-related protein Rab-5C; RAB; member of RAS oncogene family like; member of RAS oncogene family; RAB5CL; RAB5C, member of RAS oncogene family; L1880; RAB5L; MGC117217; MGC138857; |
Gene ID | 5878 |
mRNA Refseq | NM_001252039 |
Protein Refseq | NP_001238968 |
MIM | 604037 |
UniProt ID | P51148 |
◆ Recombinant Proteins | ||
RAB5C-714HFL | Active Recombinant Full Length Human RAB5C Protein, C-Flag-tagged | +Inquiry |
RAB5C-1839H | Recombinant Human RAB5C Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB5C-3574R | Recombinant Rhesus Macaque RAB5C Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB5C-11546Z | Recombinant Zebrafish RAB5C | +Inquiry |
RAB5C-3757R | Recombinant Rhesus monkey RAB5C Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB5C-524HCL | Recombinant Human RAB5C lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAB5C Products
Required fields are marked with *
My Review for All RAB5C Products
Required fields are marked with *
0
Inquiry Basket